MRE11 (NM_005591) Human Tagged ORF Clone

CAT#: RC209414

Reviews ()
Write a review

MRE11A (Myc-DDK-tagged)-Human MRE11 meiotic recombination 11 homolog A (S. cerevisiae) (MRE11A), transcript variant 1



Reconstitution Protocol

USD 648.00

In Stock*

Size
    • 10 ug

Product images

Other products for "MRE11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MRE11
Synonyms ATLD; HNGS1; MRE11A; MRE11B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209414 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTACTGCAGATGCACTTGATGATGAAAACACATTTAAAATATTAGTTGCAACAGATATTCATCTTG
GATTTATGGAGAAAGATGCAGTCAGAGGAAATGATACGTTTGTAACACTCGATGAAATTTTAAGACTTGC
CCAGGAAAATGAAGTGGATTTTATTTTGTTAGGTGGTGATCTTTTTCATGAAAATAAGCCCTCAAGGAAA
ACATTACATACCTGCCTCGAGTTATTAAGAAAATATTGTATGGGTGATCGGCCTGTCCAGTTTGAAATTC
TCAGTGATCAGTCAGTCAACTTTGGTTTTAGTAAGTTTCCATGGGTGAACTATCAAGATGGCAACCTCAA
CATTTCAATTCCAGTGTTTAGTATTCATGGCAATCATGACGATCCCACAGGGGCAGATGCACTTTGTGCC
TTGGACATTTTAAGTTGTGCTGGATTTGTAAATCACTTTGGACGTTCAATGTCTGTGGAGAAGATAGACA
TTAGTCCGGTTTTGCTTCAAAAAGGAAGCACAAAGATTGCGCTATATGGTTTAGGATCCATTCCAGATGA
AAGGCTCTATCGAATGTTTGTCAATAAAAAAGTAACAATGTTGAGACCAAAGGAAGATGAGAACTCTTGG
TTTAACTTATTTGTGATTCATCAGAACAGGAGTAAACATGGAAGTACTAACTTCATTCCAGAACAATTTT
TGGATGACTTCATTGATCTTGTTATCTGGGGCCATGAACATGAGTGTAAAATAGCTCCAACCAAAAATGA
ACAACAGCTGTTTTATATCTCACAACCTGGAAGCTCAGTGGTTACTTCTCTTTCCCCAGGAGAAGCTGTA
AAGAAACATGTTGGTTTGCTGCGTATTAAAGGGAGGAAGATGAATATGCATAAAATTCCTCTTCACACAG
TGCGGCAGTTTTTCATGGAGGATATTGTTCTAGCTAATCATCCAGACATTTTTAACCCAGATAATCCTAA
AGTAACCCAAGCCATACAAAGCTTCTGTTTGGAGAAGATTGAAGAAATGCTTGAAAATGCTGAACGGGAA
CGTCTGGGTAATTCTCACCAGCCAGAGAAGCCTCTTGTACGACTGCGAGTGGACTATAGTGGAGGTTTTG
AACCTTTCAGTGTTCTTCGCTTTAGCCAGAAATTTGTGGATCGGGTAGCTAATCCAAAAGACATTATCCA
TTTTTTCAGGCATAGAGAACAAAAGGAAAAAACAGGAGAAGAGATCAACTTTGGGAAACTTATCACAAAG
CCTTCAGAAGGAACAACTTTAAGGGTAGAAGATCTTGTAAAACAGTACTTTCAAACCGCAGAGAAGAATG
TGCAGCTCTCACTGCTAACAGAAAGAGGGATGGGTGAAGCAGTACAAGAATTTGTGGACAAGGAGGAGAA
AGATGCCATTGAGGAATTAGTGAAATACCAGTTGGAAAAAACACAGCGATTTCTTAAAGAACGTCATATT
GATGCCCTCGAAGACAAAATCGATGAGGAGGTACGTCGTTTCAGAGAAACCAGACAAAAAAATACTAATG
AAGAAGATGATGAAGTCCGTGAGGCTATGACCAGGGCCAGAGCACTCAGATCTCAGTCAGAGGAGTCTGC
TTCTGCCTTTAGTGCTGATGACCTTATGAGTATAGATTTAGCAGAACAGATGGCTAATGACTCTGATGAT
AGCATCTCAGCAGCAACCAACAAAGGAAGAGGCCGAGGAAGAGGTCGAAGAGGTGGAAGAGGGCAGAATT
CAGCATCGAGAGGAGGGTCTCAAAGAGGAAGAGCAGACACTGGTCTGGAGACTTCTACCCGTAGCAGGAA
CTCAAAGACTGCTGTGTCAGCATCTAGAAATATGTCTATTATAGATGCCTTTAAATCTACAAGACAGCAG
CCTTCCCGAAATGTCACTACTAAGAATTATTCAGAGGTGATTGAGGTAGATGAATCAGATGTGGAAGAAG
ACATTTTTCCTACCACTTCAAAGACAGATCAAAGGTGGTCCAGCACATCATCCAGCAAAATCATGTCCCA
GAGTCAAGTATCGAAAGGGGTTGATTTTGAATCAAGTGAGGATGATGATGATGATCCTTTTATGAACACT
AGTTCTTTAAGAAGAAATAGAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209414 protein sequence
Red=Cloning site Green=Tags(s)

MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRK
TLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCA
LDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSW
FNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAV
KKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERE
RLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITK
PSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHI
DALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAEQMANDSDD
SISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLETSTRSRNSKTAVSASRNMSIIDAFKSTRQQ
PSRNVTTKNYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSKIMSQSQVSKGVDFESSEDDDDDPFMNT
SSLRRNRR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005591
ORF Size 2124 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005591.4
RefSeq Size 5141 bp
RefSeq ORF 2127 bp
Locus ID 4361
UniProt ID P49959
Cytogenetics 11q21
Domains Metallophos, Mre11_DNA_bind
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Homologous recombination, Non-homologous end-joining
MW 80.6 kDa
Gene Summary This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.