PM20D1 (NM_152491) Human Tagged ORF Clone

CAT#: RC209009

Reviews ()
Write a review

PM20D1 (Myc-DDK-tagged)-Human peptidase M20 domain containing 1 (PM20D1)



  "NM_152491" in other vectors (6)

Reconstitution Protocol

USD 467.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PM20D1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PM20D1
Synonyms Cps1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209009 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCAGCGGTGCGTTTGCGTGCTGGCCCTGGTGGCTATGCTGCTCCTAGTTTTCCCTACCGTCTCCA
GATCGATGGGCCCGAGGAGCGGGGAGCATCAAAGGGCGTCGCGAATCCCTTCTCAGTTCAGCAAAGAGGA
ACGCGTCGCGATGAAAGAGGCGCTGAAAGGTGCCATCCAGATTCCAACAGTGACTTTTAGCTCTGAGAAG
TCCAATACTACAGCCCTGGCTGAGTTCGGAAAATACATTCATAAAGTCTTTCCTACAGTGGTCAGCACCA
GCTTTATCCAGCATGAAGTCGTGGAAGAGTATAGCCACCTGTTCACTATCCAAGGCTCGGACCCCAGCTT
GCAGCCCTACCTGCTGATGGCTCACTTTGATGTGGTGCCTGCCCCTGAAGAAGGCTGGGAGGTGCCCCCA
TTCTCTGGGTTGGAGCGTGATGGCGTCATCTATGGTTGGGGCACACTGGACGACAAGAACTCTGTGATGG
CATTACTGCAGGCCTTGGAGCTCCTGCTGATCAGGAAGTACATCCCCCGAAGATCTTTCTTCATTTCTCT
GGGCCATGATGAGGAGTCATCAGGGACAGGGGCTCAGAGGATCTCAGCCCTGCTACAGTCAAGGGGCGTC
CAGCTAGCCTTCATTGTGGACGAGGGGGGCTTCATCTTGGATGATTTCATTCCTAACTTCAAGAAGCCCA
TCGCCTTGATTGCAGTCTCAGAGAAGGGTTCCATGAACCTCATGCTGCAAGTAAACATGACTTCAGGCCA
CTCTTCAGCTCCTCCAAAGGAGACAAGCATTGGCATCCTTGCAGCTGCTGTCAGCCGATTGGAGCAGACA
CCAATGCCTATCATATTTGGAAGCGGGACAGTGGTGACTGTATTGCAGCAACTGGCAAATGAGTTTCCCT
TCCCTGTCAATATAATCCTGAGCAACCCATGGCTATTTGAACCACTTATAAGCAGGTTTATGGAGAGAAA
TCCCTTAACCAATGCAATAATCAGGACCACCACGGCACTCACCATATTCAAAGCAGGGGTCAAGTTCAAT
GTCATCCCCCCAGTGGCCCAGGCCACAGTCAACTTCCGGATTCACCCTGGACAGACAGTCCAAGAGGTCC
TAGAACTCACGAAGAACATTGTGGCTGATAACAGAGTCCAGTTCCATGTGTTGAGTGCCTTTGACCCCCT
CCCCGTCAGCCCTTCTGATGACAAGGCCTTGGGCTACCAGCTGCTCCGCCAGACCGTACAGTCCGTCTTC
CCGGAAGTCAATATTACTGCCCCAGTTACTTCTATTGGCAACACAGACAGCCGATTCTTTACAAACCTCA
CCACTGGCATCTACAGGTTCTACCCCATCTACATACAGCCTGAAGACTTCAAACGCATCCATGGAGTCAA
CGAGAAAATCTCAGTCCAAGCCTATGAGACCCAAGTGAAATTCATCTTTGAGTTGATTCAGAATGCTGAC
ACAGACCAGGAGCCAGTTTCTCACCTGCACAAACTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC209009 protein sequence
Red=Cloning site Green=Tags(s)

MAQRCVCVLALVAMLLLVFPTVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEK
SNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPP
FSGLERDGVIYGWGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRISALLQSRGV
QLAFIVDEGGFILDDFIPNFKKPIALIAVSEKGSMNLMLQVNMTSGHSSAPPKETSIGILAAAVSRLEQT
PMPIIFGSGTVVTVLQQLANEFPFPVNIILSNPWLFEPLISRFMERNPLTNAIIRTTTALTIFKAGVKFN
VIPPVAQATVNFRIHPGQTVQEVLELTKNIVADNRVQFHVLSAFDPLPVSPSDDKALGYQLLRQTVQSVF
PEVNITAPVTSIGNTDSRFFTNLTTGIYRFYPIYIQPEDFKRIHGVNEKISVQAYETQVKFIFELIQNAD
TDQEPVSHLHKL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_152491
ORF Size 1506 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_152491.2
RefSeq Size 2200 bp
RefSeq ORF 1509 bp
Locus ID 148811
UniProt ID Q6GTS8
Cytogenetics 1q32.1
Protein Families Transmembrane
MW 55.8 kDa
Gene Summary Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.