FOXQ1 (NM_033260) Human Tagged ORF Clone

CAT#: RC208831

FOXQ1 (Myc-DDK-tagged)-Human forkhead box Q1 (FOXQ1)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOXQ1 (NM_033260) Human Tagged ORF Clone
Symbol FOXQ1
Synonyms HFH1
Vector pCMV6-Entry
Sequence Data
>RC208831 representing NM_033260
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTGGAGGTGTTCGTCCCTCGCGCGGCCCACGGGGACAAGCAGGGCAGTGACCTGGAGGGCGCGG
GCGGCAGCGACGCGCCGTCCCCGCTGTCGGCGGCGGGAGACGACTCCCTGGGCTCAGATGGGGACTGCGC
GGCCAACAGCCCGGCCGCGGGCGGCGGCGCCAGAGATCCGCCGGGCGACGGCGAACAGAGTGCGGGAGGC
GGGCCGGGCGCGGAGGAGGCGATCCCGGCAGCAGCTGCTGCAGCGGTGGTGGCGGAGGGCGCGGAGGCCG
GGGCGGCGGGGCCAGGCGCGGGCGGCGCGGGGAGCGGCGAGGGTGCACGCAGCAAGCCATATACGCGGCG
GCCCAAGCCCCCCTACTCGTACATCGCGCTCATCGCCATGGCCATCCGCGACTCGGCGGGCGGGCGCTTG
ACGCTGGCGGAGATCAACGAGTACCTCATGGGCAAGTTCCCCTTTTTCCGCGGCAGCTACACGGGCTGGC
GCAACTCCGTGCGCCACAACCTTTCGCTCAACGACTGCTTCGTCAAGGTGCTGCGCGACCCCTCGCGGCC
CTGGGGCAAGGACAACTACTGGATGCTCAACCCCAACAGCGAGTACACCTTCGCCGACGGGGTCTTCCGC
CGCCGCCGCAAGCGCCTCAGCCACCGCGCGCCGGTCCCCGCGCCCGGGCTGCGGCCCGAGGAGGCCCCGG
GCCTCCCCGCCGCCCCGCCGCCCGCGCCCGCCGCCCCGGCCTCGCCCCGCATGCGCTCGCCCGCCCGCCA
GGAGGAGCGCGCCAGCCCCGCGGGCAAGTTCTCCAGCTCCTTCGCCATCGACAGCATCCTGCGCAAGCCC
TTCCGCAGCCGCCGCCTCAGGGACACGGCCCCCGGGACGACGCTTCAGTGGGGCGCCGCGCCCTGCCCGC
CGCTGCCCGCGTTCCCCGCGCTCCTCCCCGCGGCGCCCTGCAGGGCCCTGCTGCCGCTCTGCGCGTACGG
CGCGGGCGAGCCGGCGCGGCTGGGCGCGCGCGAGGCCGAGGTGCCACCGACCGCGCCGCCCCTCCTGCTT
GCACCTCTCCCGGCGGCGGCCCCCGCCAAGCCACTCCGAGGCCCGGCGGCCGGCGGCGCGCACCTGTACT
GCCCCCTGCGGCTGCCCGCAGCCCTGCAGGCGGCCTCAGTCCGCCGCCCTGGCCCGCACCTGCCGTACCC
GGTGGAGACGCTCCTAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208831 representing NM_033260
Red=Cloning site Green=Tags(s)

MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDPPGDGEQSAGG
GPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRL
TLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFR
RRRKRLSHRAPVPAPGLRPEEAPGLPAAPPPAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKP
FRSRRLRDTAPGTTLQWGAAPCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLL
APLPAAAPAKPLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_033260
ORF Size 1209 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_033260.2, NM_033260.3, NP_150285
RefSeq Size 2322
RefSeq ORF 1212
Locus ID 94234
Cytogenetics 6p25.3
Protein Families Transcription Factors
MW 41.3 kDa
Gene Summary FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM, May 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)