Eph receptor B3(EPHB3) (NM_004443) Human Tagged ORF Clone

CAT#: RC208364

EPHB3 (Myc-DDK-tagged)-Human EPH receptor B3 (EPHB3)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Eph receptor B3(EPHB3) (NM_004443) Human Tagged ORF Clone
Symbol EPHB3
Synonyms EK2; ETK2; HEK2; TYRO6
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208364 representing NM_004443
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGAGCCCGCCCGCCGCCGCCGCCGTCGCCGCCGCCGGGGCTTCTGCCGCTGCTCCCTCCGCTGC
TGCTGCTGCCGCTGCTGCTGCTGCCCGCCGGCTGCCGGGCGCTGGAAGAGACCCTCATGGACACAAAATG
GGTAACATCTGAGTTGGCGTGGACATCTCATCCAGAAAGTGGGTGGGAAGAGGTGAGTGGCTACGATGAG
GCCATGAATCCCATCCGCACATACCAGGTGTGTAATGTGCGCGAGTCAAGCCAGAACAACTGGCTTCGCA
CGGGGTTCATCTGGCGGCGGGATGTGCAGCGGGTCTACGTGGAGCTCAAGTTCACTGTGCGTGACTGCAA
CAGCATCCCCAACATCCCCGGCTCCTGCAAGGAGACCTTCAACCTCTTCTACTACGAGGCTGACAGCGAT
GTGGCCTCAGCCTCCTCCCCCTTCTGGATGGAGAACCCCTACGTGAAAGTGGACACCATTGCACCCGATG
AGAGCTTCTCGCGGCTGGATGCCGGCCGTGTCAACACCAAGGTGCGCAGCTTTGGGCCACTTTCCAAGGC
TGGCTTCTACCTGGCCTTCCAGGACCAGGGCGCCTGCATGTCGCTCATCTCCGTGCGCGCCTTCTACAAG
AAGTGTGCATCCACCACCGCAGGCTTCGCACTCTTCCCCGAGACCCTCACTGGGGCGGAGCCCACCTCGC
TGGTCATTGCTCCTGGCACCTGCATCCCTAACGCCGTGGAGGTGTCGGTGCCACTCAAGCTCTACTGCAA
CGGCGATGGGGAGTGGATGGTGCCTGTGGGTGCCTGCACCTGTGCCACCGGCCATGAGCCAGCTGCCAAG
GAGTCCCAGTGCCGCCCCTGTCCCCCTGGGAGCTACAAGGCGAAGCAGGGAGAGGGGCCCTGCCTCCCAT
GTCCCCCCAACAGCCGTACCACCTCCCCAGCCGCCAGCATCTGCACCTGCCACAATAACTTCTACCGTGC
AGACTCGGACTCTGCGGACAGTGCCTGTACCACCGTGCCATCTCCACCCCGAGGTGTGATCTCCAATGTG
AATGAAACCTCACTGATCCTCGAGTGGAGTGAGCCCCGGGACCTGGGTGGCCGGGATGACCTCCTGTACA
ATGTCATCTGCAAGAAGTGCCATGGGGCTGGAGGGGCCTCAGCCTGCTCACGCTGTGATGACAACGTGGA
GTTTGTGCCTCGGCAGCTGGGCCTGACGGAGCGCCGGGTCCACATCAGCCATCTGCTGGCCCACACGCGC
TACACCTTTGAGGTGCAGGCGGTCAACGGTGTCTCGGGCAAGAGCCCTCTGCCGCCTCGTTATGCGGCCG
TGAATATCACCACAAACCAGGCTGCCCCGTCTGAAGTGCCCACACTACGCCTGCACAGCAGCTCAGGCAG
CAGCCTCACCCTATCCTGGGCACCCCCAGAGCGGCCCAACGGAGTCATCCTGGACTACGAGATGAAGTAC
TTTGAGAAGAGCGAGGGCATCGCCTCCACAGTGACCAGCCAGATGAACTCCGTGCAGCTGGACGGGCTTC
GGCCTGACGCCCGCTATGTGGTCCAGGTCCGTGCCCGCACAGTAGCTGGCTATGGGCAGTACAGCCGCCC
TGCCGAGTTTGAGACCACAAGTGAGAGAGGCTCTGGGGCCCAGCAGCTCCAGGAGCAGCTTCCCCTCATC
GTGGGCTCCGCTACAGCTGGGCTTGTCTTCGTGGTGGCTGTCGTGGTCATCGCTATCGTCTGCCTCAGGA
AGCAGCGACACGGCTCTGATTCGGAGTACACGGAGAAGCTGCAGCAGTACATTGCTCCTGGAATGAAGGT
TTATATTGACCCTTTTACCTACGAGGACCCTAATGAGGCTGTTCGGGAGTTTGCCAAGGAGATCGACGTG
TCCTGCGTCAAGATCGAGGAGGTGATCGGAGCTGGGGAATTTGGGGAAGTGTGCCGTGGTCGACTGAAAC
AGCCTGGCCGCCGAGAGGTGTTTGTGGCCATCAAGACGCTGAAGGTGGGCTACACCGAGAGGCAGCGGCG
GGACTTCCTAAGCGAGGCCTCCATCATGGGTCAGTTTGATCACCCCAATATAATCCGGCTCGAGGGCGTG
GTCACCAAAAGTCGGCCAGTTATGATCCTCACTGAGTTCATGGAAAACTGCGCCCTGGACTCCTTCCTCC
GGCTCAACGATGGGCAGTTCACGGTCATCCAGCTGGTGGGCATGTTGCGGGGCATTGCTGCCGGCATGAA
GTACCTGTCCGAGATGAACTATGTGCACCGCGACCTGGCTGCTCGCAACATCCTTGTCAACAGCAACCTG
GTCTGCAAAGTCTCAGACTTTGGCCTCTCCCGCTTCCTGGAGGATGACCCCTCCGATCCTACCTACACCA
GTTCCCTGGGCGGGAAGATCCCCATCCGCTGGACTGCCCCAGAGGCCATAGCCTATCGGAAGTTCACTTC
TGCTAGTGATGTCTGGAGCTACGGAATTGTCATGTGGGAGGTCATGAGCTATGGAGAGCGACCCTACTGG
GACATGAGCAACCAGGATGTCATCAATGCCGTGGAGCAGGATTACCGGCTGCCACCACCCATGGACTGTC
CCACAGCACTGCACCAGCTCATGCTGGACTGCTGGGTGCGGGACCGGAACCTCAGGCCCAAATTCTCCCA
GATTGTCAATACCCTGGACAAGCTCATCCGCAATGCTGCCAGCCTCAAGGTCATTGCCAGCGCTCAGTCT
GGCATGTCACAGCCCCTCCTGGACCGCACGGTCCCAGATTACACAACCTTCACGACAGTTGGTGATTGGC
TGGATGCCATCAAGATGGGGCGGTACAAGGAGAGCTTCGTCAGTGCGGGGTTTGCATCTTTTGACCTGGT
GGCCCAGATGACGGCAGAAGACCTGCTCCGTATTGGGGTCACCCTGGCCGGCCACCAGAAGAAGATCCTG
AGCAGTATCCAGGACATGCGGCTGCAGATGAACCAGACGCTGCCTGTGCAGGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208364 representing NM_004443
Red=Cloning site Green=Tags(s)

MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPESGWEEVSGYDE
AMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSD
VASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSFGPLSKAGFYLAFQDQGACMSLISVRAFYK
KCASTTAGFALFPETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAK
ESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNV
NETSLILEWSEPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKY
FEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSERGSGAQQLQEQLPLI
VGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDV
SCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGV
VTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNL
VCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQS
GMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKIL
SSIQDMRLQMNQTLPVQV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004443
ORF Size 2994 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004443.1, NM_004443.2, NM_004443.3, NP_004434
RefSeq Size 4234
RefSeq ORF 2997
Locus ID 2049
Cytogenetics 3q27.1
Protein Families Protein Kinase, Transmembrane, Druggable Genome
Protein Pathways Axon guidance
MW 110.33 kDa
Gene Summary Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into two groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. This gene encodes a receptor for ephrin-B family members. [provided by RefSeq, Mar 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)