RNF11 (NM_014372) Human Tagged ORF Clone

CAT#: RC208220

RNF11 (Myc-DDK-tagged)-Human ring finger protein 11 (RNF11)

Product Images

Circular map for RC208220

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY RNF11 (Cat# RC208220, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RNF11(Cat# TA811049). Positive lysates LY402321 (100ug) and LC402321 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY402321) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC208220 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified RNF11 protein (Cat# TP308220). The protein was produced from HEK293T cells transfected with RNF11 cDNA clone (Cat# RC208220) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RNF11
• Synonyms: CGI-123; SID1669
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC208220 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGGAACTGCCTCAAATCCCCCACCTCGGATGACATCTCCCTGCTTCACGAGTCTCAGTCCGACCGGG
  CTAGCTTTGGCGAGGGGACGGAGCCGGATCAGGAGCCGCCGCCGCCATATCAGGAACAAGTTCCAGTTCC
  AGTCTACCACCCAACACCTAGCCAGACTCGGCTAGCAACTCAGCTGACTGAAGAGGAACAAATTAGGATA
  GCTCAAAGAATAGGTCTTATACAACATCTGCCTAAAGGAGTTTATGACCCTGGAAGAGATGGATCAGAAA
  AAAAGATCCGGGAGTGTGTGATCTGTATGATGGACTTTGTTTATGGGGACCCAATTCGATTTCTGCCGTG
  CATGCACATCTATCACCTGGACTGTATAGATGACTGGTTGATGAGATCCTTCACGTGCCCCTCCTGCATG
  GAGCCAGTTGATGCAGCACTGCTTTCATCCTATGAGACTAAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC208220 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI
  AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM
  EPVDAALLSSYETN
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014372
• ORF Size: 462 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014372.5
• RefSeq Size: 3082 bp
• RefSeq ORF: 465 bp
• Locus ID: 26994
• UniProt ID: Q9Y3C5
• Cytogenetics: 1p32.3
• Domains: RING
• Protein Families: Druggable Genome
• MW: 17.4 kDa
• Gene Summary: The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). [provided by RefSeq, Jul 2008]