ETV7 (NM_016135) Human Tagged ORF Clone

CAT#: RC207742

Reviews ()
Write a review

ETV7 (Myc-DDK-tagged)-Human ets variant 7 (ETV7), transcript variant 1



  "NM_016135" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ETV7
Synonyms TEL-2; TEL2; TELB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207742 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGAGGGAGAATTGGCTATTTCTCCTATAAGCCCTGTGGCAGCCATGCCTCCCCTAGGCACCCACG
TGCAAGCCAGATGTGAAGCTCAAATTAACCTGCTGGGTGAAGGGGGGATCTGCAAGCTGCCAGGAAGACT
CCGCATCCAGCCCGCACTGTGGAGCAGGGAGGACGTGCTGCACTGGCTGCGCTGGGCAGAGCAGGAGTAC
TCTCTGCCATGCACCGCGGAGCACGGGTTCGAGATGAACGGACGCGCCCTCTGCATCCTCACCAAGGACG
ACTTCCGGCACCGTGCGCCCAGCTCAGGTGACGTCCTGTATGAGCTGCTCCAGTACATCAAGACCCAGCG
GCGAGCCCTGGTGTGTGGACCCTTTTTTGGAGGGATCTTCAGGCTGAAGACGCCCACCCAGCACTCTCCA
GTCCCCCCGGAAGAGGTGACTGGCCCCTCTCAGATGGACACCCGAAGGGGCCACCTGCTGCAGCCACCAG
ACCCAGGGCTTACCAGCAACTTCGGCCACCTGGATGACCCTGGCCTGGCAAGGTGGACCCCTGGCAAGGA
GGAGTCCCTCAACTTATGTCACTGTGCAGAGCTCGGCTGCAGGACCCAGGGGGTCTGTTCCTTCCCCGCG
ATGCCGCAGGCCCCCATTGACGGCAGGATCGCTGACTGCCGCCTGCTGTGGGATTACGTGTATCAGCTGC
TCCTTGATACCCGATATGAGCCCTACATCAAGTGGGAAGACAAGGACGCCAAGATCTTCCGAGTTGTGGA
TCCAAATGGGCTCGCCAGACTCTGGGGAAATCACAAGAACCGGGTGAACATGACCTACGAGAAGATGTCT
CGTGCCCTGCGCCACTATTATAAGCTTAATATCATTAAGAAGGAACCGGGGCAGAAACTCCTGTTCAGAT
TTCTAAAGACTCCGGGAAAGATGGTCCAGGACAAGCACAGCCACCTGGAGCCGCTGGAGAGCCAGGAGCA
GGACAGAATAGAGTTCAAGGACAAGAGGCCAGAAATCTCTCCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207742 protein sequence
Red=Cloning site Green=Tags(s)

MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEY
SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSP
VPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA
MPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMS
RALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016135
ORF Size 1023 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016135.2, NP_057219.1
RefSeq Size 1761 bp
RefSeq ORF 1026 bp
Locus ID 51513
UniProt ID Q9Y603
Cytogenetics 6p21.31
Domains ETS, SAM_PNT, SAPA, SapB_1, SapB_2, SAPB
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Dorso-ventral axis formation
MW 39 kDa
Gene Summary The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721).[provided by RefSeq, May 2011]

Other Versions

Other products for "ETV7"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
    • 100 ul

USD 417.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.