DLX2 (NM_004405) Human Tagged ORF Clone

CAT#: RC207545

DLX2 (Myc-DDK-tagged)-Human distal-less homeobox 2 (DLX2)

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DLX2 (NM_004405) Human Tagged ORF Clone
Symbol DLX2
Synonyms TES-1; TES1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207545 representing NM_004405
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGGAGTCTTTGACAGTCTAGTGGCTGATATGCACTCGACCCAGATCGCCGCCTCCAGCACGTACC
ACCAGCACCAGCAGCCCCCGAGCGGCGGCGGCGCCGGCCCGGGTGGCAACAGCAGCAGCAGCAGCAGCCT
CCACAAGCCCCAGGAGTCGCCCACCCTTCCGGTGTCCACCGCCACCGACAGCAGCTACTACACCAACCAG
CAGCACCCGGCGGGCGGCGGCGGCGGCGGGGGCTCGCCCTACGCGCACATGGGTTCCTACCAGTACCAAG
CCAGCGGCCTCAACAACGTCCCTTACTCCGCCAAGAGCAGCTATGACCTGGGCTACACCGCCGCCTACAC
CTCCTACGCTCCCTATGGAACCAGTTCGTCCCCAGCCAACAACGAGCCTGAGAAGGAGGACCTTGAGCCT
GAAATTCGGATAGTGAACGGGAAGCCAAAGAAAGTCCGGAAACCCCGCACCATCTACTCCAGTTTCCAGC
TGGCGGCTCTTCAGCGGCGTTTCCAAAAGACTCAATACTTGGCCTTGCCGGAGCGAGCCGAGCTGGCGGC
CTCTCTGGGCCTCACCCAGACTCAGGTCAAAATCTGGTTCCAGAACCGCCGGTCCAAGTTCAAGAAGATG
TGGAAAAGTGGTGAGATCCCCTCGGAGCAGCACCCTGGGGCCAGCGCTTCTCCACCTTGTGCTTCGCCGC
CAGTCTCAGCGCCGGCCTCCTGGGACTTTGGTGTGCCGCAGCGGATGGCGGGCGGCGGTGGTCCGGGCAG
TGGCGGCAGCGGCGCCGGCAGCTCGGGCTCCAGCCCGAGCAGCGCGGCCTCGGCTTTTCTGGGCAACTAC
CCCTGGTACCACCAGACCTCGGGATCCGCCTCACACCTGCAGGCCACGGCGCCGCTGCTGCACCCCACTC
AGACCCCGCAGCCGCATCACCACCACCACCATCACGGCGGCGGGGGCGCCCCGGTGAGCGCGGGGACGAT
TTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207545 representing NM_004405
Red=Cloning site Green=Tags(s)

MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQ
QHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEP
EIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKM
WKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNY
PWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004405
ORF Size 984 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004405.2, NM_004405.3, NP_004396
RefSeq Size 2091
RefSeq ORF 987
Locus ID 1746
Cytogenetics 2q31.1
Protein Families Stem cell relevant signaling - TGFb/BMP signaling pathway, ES Cell Differentiation/IPS, Transcription Factors
MW 34.1 kDa
Gene Summary Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations