RNF4 (NM_002938) Human Tagged ORF Clone

CAT#: RC207273

Reviews ()
Write a review

RNF4 (Myc-DDK-tagged)-Human ring finger protein 4 (RNF4), transcript variant 2



  "NM_002938" in other vectors (6)

Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "RNF4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RNF4
Synonyms RES4-26; SLX5; SNURF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207273 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTACAAGAAAGCGTCGTGGTGGAGCAATAAATTCTAGACAAGCTCAGAAGCGAACTCGGGAAGCGA
CCTCCACCCCCGAGATCTCCTTGGAAGCAGAACCCATAGAACTCGTGGAAACTGCTGGAGATGAAATTGT
GGACCTCACTTGTGAATCTTTAGAGCCTGTGGTGGTTGATCTGACTCACAATGACTCTGTTGTGATTGTT
GACGAAAGAAGAAGACCAAGGAGGAATGCTAGGAGGCTGCCCCAGGACCATGCTGACAGCTGTGTGGTGA
GCAGTGACGATGAGGAGTTGTCCAGGGACAGGGACGTATATGTGACTACCCATACTCCCAGAAACGCCAG
GGATGAGGGCGCTACAGGCCTCAGGCCCTCAGGTACTGTCAGTTGTCCCATCTGCATGGACGGATACTCA
GAGATCGTGCAGAATGGACGTCTCATCGTTTCCACAGAATGCGGCCATGTCTTCTGTAGCCAGTGCCTCC
GTGATTCCCTGAAGAATGCTAATACTTGCCCAACTTGTAGGAAAAAGATCAACCACAAACGGTACCACCC
CATTTATATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207273 protein sequence
Red=Cloning site Green=Tags(s)

MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIV
DERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYS
EIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002938
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002938.5
RefSeq Size 2971 bp
RefSeq ORF 573 bp
Locus ID 6047
UniProt ID P78317
Cytogenetics 4p16.3
Domains RING
Protein Families Transcription Factors
MW 21.3 kDa
Gene Summary The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription repressor ZNF278/PATZ is found to interact with this protein, and thus reduce the enhancement of androgen receptor-dependent transcription mediated by this protein. Studies of the mouse and rat counterparts suggested a role of this protein in spermatogenesis. A pseudogene of this gene is found on chromosome 1.[provided by RefSeq, Jul 2010]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.