CCDC8 (NM_032040) Human Tagged ORF Clone

CAT#: RC206818

CCDC8 (Myc-DDK-tagged)-Human coiled-coil domain containing 8 (CCDC8)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CCDC8 (NM_032040) Human Tagged ORF Clone
Symbol CCDC8
Synonyms 3M3; p90; PPP1R20
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206818 representing NM_032040
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCAGATCGGGGAGGACGTCGACTATTTGCTCATCCCCCGGGAGGTCAGGCTGGCTGGGGGCGTCT
GGAGAGTCATCTCTAAGCCCGCCACCAAGGAAGCAGAATTTCGGGAGCGGCTGACCCAGTTCCTGGAAGA
AGAGGGCCGCACCCTGGAGGACGTGGCCCGCATCATGGAGAAGAGCACCCCGCACCCGCCCCAGCCCCCC
AAAAAGCCCAAGGAGCCCCGAGTGAGGAGGAGAGTGCAGCAGATGGTGACTCCTCCGCCCCGGCTGGTCG
TGGGCACGTACGACAGCAGCAACGCCAGCGACAGCGAGTTCAGCGACTTCGAGACCTCCAGAGACAAGAG
CCGCCAGGGCCCGCGGCGGGGCAAGAAGGTGCGCAAAATGCCCGTCAGCTACCTGGGCAGCAAGTTCCTG
GGAAGCGACCTGGAGAGTGAGGATGATGAGGAACTGGTCGAGGCCTTCCTCCGGCGACAGGAGAAGCAGC
CCAGCGCGCCGCCTGCCCGCCGCCGCGTCAACCTGCCAGTGCCCATGTTTGAGGACAACCTGGGGCCTCA
GCTGTCCAAAGCGGACAGGTGGCGGGAGTATGTCAGCCAGGTGTCCTGGGGGAAGCTGAAGCGGAGGGTG
AAGGGTTGGGCGCCGAGGGCGGGCCCCGGGGTGGGCGAGGCCCGGCTGGCCTCCACCGCAGTGGAGAGCG
CAGGGGTATCATCGGCGCCAGAGGGCACCAGCCCGGGGGATCGCTTGGGAAACGCGGGAGATGTTTGTGT
GCCCCAGGCTTCCCCTAGGCGATGGAGGCCCAAGATCAACTGGGCCTCCTTTCGGCGCCGCAGGAAGGAG
CAGACAGCACCCACAGGTCAGGGGGCAGACATCGAGGCTGATCAGGGGGGAGAGGCTGCAGATAGTCAAA
GGGAAGAGGCCATAGCTGACCAGCGGGAAGGGGCTGCAGGTAATCAGAGGGCAGGGGCCCCAGCTGACCA
GGGGGCAGAGGCTGCAGATAATCAGAGGGAAGAGGCTGCAGATAATCAGAGGGCAGGGGCCCCAGCTGAG
GAGGGGGCAGAGGCTGCAGATAACCAGAGGGAAGAGGCTGCAGATAATCAGAGGGCAGAGGCCCCAGCTG
ACCAGAGGTCACAGGGCACAGATAACCACAGGGAAGAGGCTGCAGATAATCAGAGGGCGGAGGCCCCAGC
TGACCAGGGGTCAGAGGTTACAGATAATCAAAGGGAAGAGGCCGTACATGACCAGAGGGAAAGGGCCCCA
GCTGTCCAGGGTGCAGATAATCAGAGGGCACAGGCCCGGGCTGGCCAGAGGGCAGAGGCTGCACATAATC
AGAGGGCAGGGGCCCCAGGTATCCAGGAAGCTGAAGTCTCAGCTGCCCAAGGGACCACAGGAACAGCTCC
AGGAGCCAGGGCCCGGAAACAGGTCAAGACAGTGAGGTTCCAGACCCCTGGACGCTTTTCGTGGTTTTGC
AAGCGCCGGAGAGCCTTCTGGCACACTCCCCGGTTGCCAACCCTGCCCAAGAGAGTCCCCAGGGCAGGAG
AGGCCAGGAACCTCAGGGTGCTGAGGGCCGAGGCCAGAGCAGAAGCTGAGCAGGGAGAGCAAGAAGACCA
GCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206818 representing NM_032040
Red=Cloning site Green=Tags(s)

MLQIGEDVDYLLIPREVRLAGGVWRVISKPATKEAEFRERLTQFLEEEGRTLEDVARIMEKSTPHPPQPP
KKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFL
GSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWREYVSQVSWGKLKRRV
KGWAPRAGPGVGEARLASTAVESAGVSSAPEGTSPGDRLGNAGDVCVPQASPRRWRPKINWASFRRRRKE
QTAPTGQGADIEADQGGEAADSQREEAIADQREGAAGNQRAGAPADQGAEAADNQREEAADNQRAGAPAE
EGAEAADNQREEAADNQRAEAPADQRSQGTDNHREEAADNQRAEAPADQGSEVTDNQREEAVHDQRERAP
AVQGADNQRAQARAGQRAEAAHNQRAGAPGIQEAEVSAAQGTTGTAPGARARKQVKTVRFQTPGRFSWFC
KRRRAFWHTPRLPTLPKRVPRAGEARNLRVLRAEARAEAEQGEQEDQL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032040
ORF Size 1614 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032040.1, NM_032040.2, NM_032040.3, NM_032040.4, NP_114429
RefSeq Size 2775
RefSeq ORF 1617
Locus ID 83987
Cytogenetics 19q13.32
MW 59.2 kDa
Gene Summary This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a cofactor required for p53-mediated apoptosis following DNA damage, and may also play a role in growth through interactions with the cytoskeletal adaptor protein obscurin-like 1. Mutations in this gene are a cause of 3M syndrome-3 (3M3). [provided by RefSeq, Dec 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)