CBLB(CBLB) (NM_170662) Human Tagged ORF Clone

CAT#: RC206047

CBLB (Myc-DDK-tagged)-Human Cas-Br-M (murine) ecotropic retroviral transforming sequence b (CBLB)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CBLB(CBLB) (NM_170662) Human Tagged ORF Clone
Symbol CBLB
Synonyms Cbl-b; Nbla00127; RNF56
Vector pCMV6-Entry
Sequence Data
>RC206047 representing NM_170662
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAACTCAATGAATGGCAGAAACCCTGGTGGTCGAGGAGGAAATCCCCGAAAAGGTCGAATTTTGG
GTATTATTGATGCTATTCAGGATGCAGTTGGACCCCCTAAGCAAGCTGCCGCAGATCGCAGGACCGTGGA
GAAGACTTGGAAGCTCATGGACAAAGTGGTAAGACTGTGCCAAAATCCCAAACTTCAGTTGAAAAATAGC
CCACCATATATACTTGATATTTTGCCTGATACATATCAGCATTTACGACTTATATTGAGTAAATATGATG
ACAACCAGAAACTTGCCCAACTCAGTGAGAATGAGTACTTTAAAATCTACATTGATAGCCTTATGAAAAA
GTCAAAACGGGCAATAAGACTCTTTAAAGAAGGCAAGGAGAGAATGTATGAAGAACAGTCACAGGACAGA
CGAAATCTCACAAAACTGTCCCTTATCTTCAGTCACATGCTGGCAGAAATCAAAGCAATCTTTCCCAATG
GTCAATTCCAGGGAGATAACTTTCGTATCACAAAAGCAGATGCTGCTGAATTCTGGAGAAAGTTTTTTGG
AGACAAAACTATCGTACCATGGAAAGTATTCAGACAGTGCCTTCATGAGGTCCACCAGATTAGCTCTGGC
CTGGAAGCAATGGCTCTAAAATCAACAATTGATTTAACTTGCAATGATTACATTTCAGTTTTTGAATTTG
ATATTTTTACCAGGCTGTTTCAGCCTTGGGGCTCTATTTTGCGGAATTGGAATTTCTTAGCTGTGACACA
TCCAGGTTACATGGCATTTCTCACATATGATGAAGTTAAAGCACGACTACAGAAATATAGCACCAAACCC
GGAAGCTATATTTTCCGGTTAAGTTGCACTCGATTGGGACAGTGGGCCATTGGCTATGTGACTGGGGATG
GGAATATCTTACAGACCATACCTCATAACAAGCCCTTATTTCAAGCCCTGATTGATGGCAGCAGGGAAGG
ATTTTATCTTTATCCTGATGGGAGGAGTTATAATCCTGATTTAACTGGATTATGTGAACCTACACCTCAT
GACCATATAAAAGTTACACAGGAACAATATGAATTATATTGTGAAATGGGCTCCACTTTTCAGCTCTGTA
AGATTTGTGCAGAGAATGACAAAGATGTCAAGATTGAGCCTTGTGGGCATTTGATGTGCACCTCTTGCCT
TACGGCATGGCAGGAGTCGGATGGTCAGGGCTGCCCTTTCTGTCGTTGTGAAATAAAAGGAACTGAGCCC
ATAATCGTGGATCCCTTTGATCCAAGAGATGAAGGCTCCAGGTGTTGCAGCATCATTGACCCCTTTGGCA
TGCCGATGCTCGACTTGGACGACGATGATGATCGTGAGGAGTCCTTGATGATGAATCGGTTGGCAAACGT
CCGAAAGTGCACTGACAGGCAGAACTCACCAGTCACATCACCAGGATCCTCTCCCCTTGCCCAGAGAAGA
AAGCCACAGCCTGACCCACTCCAGATCCCACATCTAAGCCTGCCACCCGTGCCTCCTCGCCTGGATCTAA
TTCAGAAAGGCATAGTTAGATCTCCCTGTGGCAGCCCAACGGGTTCACCAAAGTCTTCTCCTTGCATGGT
GAGAAAACAAGATAAACCACTCCCAGCACCACCTCCTCCCTTAAGAGATCCTCCTCCACCGCCACCTGAA
AGACCTCCACCAATCCCACCAGACAATAGACTGAGTAGACACATCCATCATGTGGAAAGCGTGCCTTCCA
AAGACCCGCCAATGCCTCTTGAAGCATGGTGCCCTCGGGATGTGTTTGGGACTAATCAGCTTGTGGGATG
TCGACTCCTAGGGGAGGGCTCTCCAAAACCTGGAATCACAGCGAGTTCAAATGTCAATGGAAGGCACAGT
AGAGTGGGCTCTGACCCAGTGCTTATGCGGAAACACAGACGCCATGATTTGCCTTTAGAAGGAGCTAAGG
TCTTTTCCAATGGTCACCTTGGAAGTGAAGAATATGATGTTCCTCCCCGGCTTTCTCCTCCTCCTCCAGT
TACCACCCTCCTCCCTAGCATAAAGTGTACTGGTCCGTTAGCAAATTCTCTTTCAGAGAAAACAAGAGAC
CCAGTAGAGGAAGATGATGATGAATACAAGATTCCTTCATCCCACCCTGTTTCCCTGAATTCACAACCAT
CTCATTGTCATAATGTAAAACCTCCTGTTCGGTCTTGTGATAATGGTCACTGTATGCTGAATGGAACACA
TGGTCCATCTTCAGAGAAGAAATCAAACATCCCTGACTTAAGCATATATTTAAAGGGAGATGTTTTTGAT
TCAGCCTCTGATCCCGTGCCATTACCACCTGCCAGGCCTCCAACTCGGGACAATCCAAAGCATGGTTCTT
CACTCAACAGGACGCCCTCTGATTATGATCTTCTCATCCCTCCATTAGGTGAAGATGCTTTTGATGCCCT
CCCTCCATCTCTCCCACCTCCCCCACCTCCTGCAAGGCATAGTCTCATTGAACATTCAAAACCTCCTGGC
TCCAGTAGCCGGCCATCCTCAGGACAGGATCTTTTTCTTCTTCCTTCAGATCCCTTTGTTGATCTAGCAA
GTGGCCAAGTTCCTTTGCCTCCCGCTAGAAGGTTACCAGGTGAAAATGTCAAAACTAACAGAACATCACA
GGACTATGATCAGCTTCCTTCATGTTCAGATGGTTCACAGGCACCAGCCAGACCCCCTAAACCACGACCG
CGCAGGACTGCACCAGAAATTCACCACAGAAAACCCCATGGGCCTGAGGCGGCATTGGAAAATGTCGATG
CAAAAATTGCAAAACTCATGGGAGAGGGTTATGCCTTTGAAGAGGTGAAGAGAGCCTTAGAGATAGCCCA
GAATAATGTCGAAGTTGCCCGGAGCATCCTCCGAGAATTTGCCTTCCCTCCTCCAGTATCCCCACGTCTA
AATCTA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC206047 representing NM_170662
Red=Cloning site Green=Tags(s)

MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNS
PPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDR
RNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSG
LEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKP
GSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPH
DHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTSPGSSPLAQRR
KPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQDKPLPAPPPPLRDPPPPPPE
RPPPIPPDNRLSRHIHHVESVPSKDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHS
RVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRD
PVEEDDDEYKIPSSHPVSLNSQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFD
SASDPVPLPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRP
RRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRL
NL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_170662
ORF Size 2946 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_170662.1, NM_170662.2, NM_170662.3, NM_170662.4, NP_733762
RefSeq Size 3976
RefSeq ORF 2949
Locus ID 868
Cytogenetics 3q13.11
Protein Families Druggable Genome
Protein Pathways ErbB signaling pathway, Ubiquitin mediated proteolysis, Endocytosis, Jak-STAT signaling pathway, T cell receptor signaling pathway, Insulin signaling pathway, Pathways in cancer, Chronic myeloid leukemia
MW 109.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)