DYRK1B (NM_004714) Human Tagged ORF Clone

CAT#: RC205861

DYRK1B (Myc-DDK-tagged)-Human dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B (DYRK1B), transcript variant a

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DYRK1B (NM_004714) Human Tagged ORF Clone
Symbol DYRK1B
Synonyms AOMS3; MIRK
Vector pCMV6-Entry
Sequence Data
>RC205861 representing NM_004714
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGTCCCACCGGGCCATGGTCCCTTCTCTGGCTTCCCAGGGCCCCAGGAGCACACGCAGGTATTGC
CTGATGTGCGGCTACTGCCTCGGAGGCTGCCCCTGGCCTTCCGGGATGCAACCTCAGCCCCGCTGCGTAA
GCTCTCTGTGGACCTCATCAAGACCTACAAGCACATCAATGAGGTATACTATGCGAAGAAGAAGCGGCGG
GCCCAGCAGGCGCCACCCCAGGATTCGAGCAACAAGAAGGAGAAGAAGGTCCTGAACCATGGTTATGATG
ACGACAACCATGACTACATCGTGCGCAGTGGCGAGCGCTGGCTGGAGCGCTACGAAATTGACTCGCTCAT
TGGCAAAGGCTCCTTTGGCCAGGTGGTGAAAGCCTATGATCATCAGACCCAGGAGCTTGTGGCCATCAAG
ATCATCAAGAACAAAAAGGCTTTCCTGAACCAGGCCCAGATTGAGCTGCGGCTGCTGGAGCTGATGAACC
AGCATGACACGGAGATGAAGTACTATATAGTACACCTGAAGCGGCACTTCATGTTCCGGAACCACCTGTG
CCTGGTATTTGAGCTGCTGTCCTACAACCTGTACGACCTCCTGCGCAACACCCACTTCCGCGGCGTCTCG
CTGAACCTGACCCGGAAGCTGGCGCAGCAGCTCTGCACGGCACTGCTCTTTCTGGCCACGCCTGAGCTCA
GCATCATTCACTGCGACCTCAAGCCCGAAAACATCTTGCTGTGCAACCCCAAGCGCAGCGCCATCAAGAT
TGTGGACTTCGGCAGCTCCTGCCAGCTTGGCCAGAGGATCTACCAGTATATCCAGAGCCGCTTCTACCGC
TCACCTGAGGTGCTCCTGGGCACACCCTACGACCTGGCCATTGACATGTGGTCCCTGGGCTGCATCCTTG
TGGAGATGCACACCGGAGAGCCCCTCTTCAGTGGCTCCAATGAGGTCGACCAGATGAACCGCATTGTGGA
GGTGCTGGGCATCCCACCGGCCGCCATGCTGGACCAGGCGCCCAAGGCTCGCAAGTACTTTGAACGGCTG
CCTGGGGGTGGCTGGACCCTACGAAGGACGAAAGAACTCAGGAAGGATTACCAGGGCCCCGGGACACGGC
GGCTGCAGGAGGTGCTGGGCGTGCAGACGGGCGGGCCCGGGGGCCGGCGGGCGGGGGAGCCGGGCCACAG
CCCCGCCGACTACCTCCGCTTCCAGGACCTGGTGCTGCGCATGCTGGAGTATGAGCCCGCCGCCCGCATC
AGCCCCCTGGGGGCTCTGCAGCACGGCTTCTTCCGCCGCACGGCCGACGAGGCCACCAACACGGGCCCGG
CAGGCAGCAGTGCCTCCACCTCGCCCGCGCCCCTCGACACCTGCCCCTCTTCCAGCACCGCCAGCTCCAT
CTCCAGTTCTGGAGGCTCCAGTGGCTCCTCCAGTGACAACCGGACCTACCGCTACAGCAACCGATATTGT
GGGGGCCCTGGGCCCCCTATCACAGACTGTGAGATGAACAGCCCCCAGGTCCCACCCTCCCAGCCGCTGC
GGCCCTGGGCAGGGGGTGATGTGCCCCACAAGACACATCAAGCCCCTGCCTCTGCCTCGTCACTGCCTGG
GACCGGGGCCCAGTTACCCCCCCAGCCCCGATACCTTGGTCGTCCCCCATCACCAACCTCACCACCACCC
CCGGAGCTGATGGATGTGAGCCTGGTGGGCGGCCCTGCTGACTGCTCCCCACCTCACCCAGCGCCTGCCC
CCCAGCACCCGGCTGCCTCAGCCCTCCGGACTCGGATGACTGGAGGTCGTCCACCCCTCCCGCCTCCTGA
TGACCCTGCCACTCTGGGGCCTCACCTGGGCCTCCGTGGTGTACCCCAGAGCACAGCAGCCAGCTCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205861 representing NM_004714
Red=Cloning site Green=Tags(s)

MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHINEVYYAKKKRR
AQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIK
IIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVS
LNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYR
SPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERL
PGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDNRTYRYSNRYC
GGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPP
PELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGRPPLPPPDDPATLGPHLGLRGVPQSTAASS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004714
ORF Size 1887 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004714.1, NM_004714.2, NP_004705
RefSeq Size 2540
RefSeq ORF 1890
Locus ID 9149
Cytogenetics 19q13.2
Protein Families Protein Kinase, Transcription Factors, Druggable Genome
MW 69 kDa
Gene Summary This gene encodes a member of a family of nuclear-localized protein kinases. The encoded protein participates in the regulation of the cell cycle. Expression of this gene may be altered in tumor cells, and mutations in this gene were found to cause abdominal obesity-metabolic syndrome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)