cIAP1 (BIRC2) (NM_001166) Human Tagged ORF Clone

CAT#: RC205373

Reviews ()
Write a review

BIRC2 (Myc-DDK-tagged)-Human baculoviral IAP repeat containing 2 (BIRC2)



  "NM_001166" in other vectors (6)

Reconstitution Protocol

USD 575.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "BIRC2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BIRC2
Synonyms API1; c-IAP1; cIAP1; Hiap-2; HIAP2; MIHB; RNF48
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205373 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAG
ATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACT
CTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCT
GGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGA
AACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGT
TTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCT
CCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTA
GAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAG
ATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTAT
TATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGG
ATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCT
GAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCA
TCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATG
TCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGC
CAAGTGGTTTCCAAGGTGTGAGTTCTTGATACGAATGAAAGGCCAAGAGTTTGTTGATGAGATTCAAGGT
AGATATCCTCATCTTCTTGAACAGCTGTTGTCAACTTCAGATACCACTGGAGAAGAAAATGCTGACCCAC
CAATTATTCATTTTGGACCTGGAGAAAGTTCTTCAGAAGATGCTGTCATGATGAATACACCTGTGGTTAA
ATCTGCCTTGGAAATGGGCTTTAATAGAGACCTGGTGAAACAAACAGTTCAAAGTAAAATCCTGACAACT
GGAGAGAACTATAAAACAGTTAATGATATTGTGTCAGCACTTCTTAATGCTGAAGATGAAAAAAGAGAAG
AGGAGAAGGAAAAACAAGCTGAAGAAATGGCATCAGATGATTTGTCATTAATTCGGAAGAACAGAATGGC
TCTCTTTCAACAATTGACATGTGTGCTTCCTATCCTGGATAATCTTTTAAAGGCCAATGTAATTAATAAA
CAGGAACATGATATTATTAAACAAAAAACACAGATACCTTTACAAGCGAGAGAACTGATTGATACCATTT
TGGTTAAAGGAAATGCTGCGGCCAACATCTTCAAAAACTGTCTAAAAGAAATTGACTCTACATTGTATAA
GAACTTATTTGTGGATAAGAATATGAAGTATATTCCAACAGAAGATGTTTCAGGTCTGTCACTGGAAGAA
CAATTGAGGAGGTTGCAAGAAGAACGAACTTGTAAAGTGTGTATGGACAAAGAAGTTTCTGTTGTATTTA
TTCCTTGTGGTCATCTGGTAGTATGCCAGGAATGTGCCCCTTCTCTAAGAAAATGCCCTATTTGCAGGGG
TATAATCAAGGGTACTGTTCGTACATTTCTCTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205373 protein sequence
Red=Cloning site Green=Tags(s)

MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARA
GFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLS
PTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFY
YIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWP
SSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQG
RYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINK
QEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEE
QLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001166
ORF Size 1854 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001166.4
RefSeq Size 3813 bp
RefSeq ORF 1857 bp
Locus ID 329
UniProt ID Q13490
Cytogenetics 11q22.2
Domains CARD, BIR, RING
Protein Families Druggable Genome
Protein Pathways Apoptosis, Focal adhesion, NOD-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis
MW 69.9 kDa
Gene Summary The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.