Stathmin 1(STMN1) (NM_203401) Human Tagged ORF Clone

CAT#: RC205073

Product images

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Specifications

Product Data

• Product Name: Stathmin 1(STMN1) (NM_203401) Human Tagged ORF Clone
• Symbol: STMN1
• Synonyms: C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN
• Vector: pCMV6-Entry
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205073 representing NM_203401
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTTCTTCTGATATCCAGGTGAAAGAACTGGAGAAGCGTGCCTCAGGCCAGGCTTTTGAGCTGATTC
  TCAGCCCTCGGTCAAAAGAATCTGTTCCAGAATTCCCCCTTTCCCCTCCAAAGAAGAAGGATTTTTCCCT
  GGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCAAGTCCCATGAAGCTGAGGTCTTGAAG
  CAGCTGGCTGAGAAACGAGAGCACGAGAAAGAAGTGCTTCAGAAGGCAATAGAAGAGAACAACAACTTCA
  GTAAAATGGCAGAAGAGAAACTGACCCACAAAATGGAAGCTAATAAAGAGAACCGAGAGGCACAAATGGC
  TGCCAAACTGGAACGTTTGCGAGAGAAGGATAAGCACATTGAAGAAGTGCGGAAGAACAAAGAATCCAAA
  GACCCTGCTGACGAGACTGAAGCTGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205073 representing NM_203401
  Red=Cloning site Green=Tags(s)
  
  MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLK
  QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK
  DPADETEAD
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• Tag: Myc-DDK
• ACCN: NM_203401
• ORF Size: 447 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: NM_203401.1, NP_981946
• RefSeq Size: 1730
• RefSeq ORF: 450
• Locus ID: 3925
• Cytogenetics: 1p36.11
• Protein Pathways: MAPK signaling pathway
• MW: 17.1 kDa
• Gene Summary: This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009].

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.