HIST4H4 (NM_175054) Human Tagged ORF Clone

CAT#: RC205064

HIST4H4 (Myc-DDK-tagged)-Human histone cluster 4, H4 (HIST4H4)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HIST4H4 (NM_175054) Human Tagged ORF Clone
Symbol HIST4H4
Synonyms H4/p; H4/p
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205064 representing NM_175054
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGGCGAGGTAAAGGTGGCAAGGGGCTGGGTAAGGGAGGCGCCAAGCGCCACCGGAAGGTGCTGC
GGGACAATATCCAAGGCATTACAAAGCCGGCGATTCGCCGTCTCGCCCGACGTGGGGGCGTCAAGCGCAT
TTCTGGTCTCATCTACGAGGAGACCCGGGGAGTCCTCAAAGTCTTCCTGGAGAACGTGATCCGTGACGCG
GTGACTTACACGGAGCACGCCAAGCGCAAGACCGTCACGGCCATGGATGTGGTGTACGCGCTGAAACGCC
AGGGTCGCACCCTTTATGGTTTCGGCGGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205064 representing NM_175054
Red=Cloning site Green=Tags(s)

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_175054
ORF Size 309 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_175054.1, NM_175054.2, NP_778224
RefSeq Size 412
RefSeq ORF 312
Locus ID 121504
Cytogenetics 12p12.3
Protein Pathways Systemic lupus erythematosus
MW 11.2 kDa
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations