GKAP1 (NM_025211) Human Tagged ORF Clone

CAT#: RC204911

Reviews ()
Write a review

GKAP1 (Myc-DDK-tagged)-Human G kinase anchoring protein 1 (GKAP1), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GKAP1
Synonyms FKSG21; GKAP42
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204911 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCAGCAGTACTTAGTTCTGTTCCCACCACCGCTTCTCGTTTTGCCCTGTTACAAGTGGATAGTG
GCAGTGGCTCTGATTCTGAACCTGGAAAAGGTAAAGGTCGAAATACTGGAAAGTCTCAAACTTTAGGAAG
CAAGTCAACTACAAATGAGAAAAAAAGAGAGAAAAGAAGAAAAAAGAAGGAACAGCAACAGAGTGAAGCA
AATGAGCTCAGGAATCTTGCTTTTAAGAAAATTCCCCAGAAATCCTCCCATGCTGTTTGTAACGCTCAAC
ATGATCTTCCATTGTCAAACCCAGTACAGAAGGATTCACGAGAAGAAAATTGGCAAGAGTGGAGACAAAG
AGATGAGCAGCTGACATCTGAAATGTTTGAAGCAGATCTTGAGAAGGCATTGTTACTAAGTAAACTAGAA
TATGAAGAGCACAAAAAGGAGTATGAAGATGCTGAAAATACTTCAACTCAGTCCAAAGTTATGAATAAAA
AAGATAAAAGAAAGAATCATCAGGGAAAAGACAGACCTCTCACAGTATCACTAAAAGATTTTCATTCGGA
AGATCACATTAGTAAAAAGACTGAGGAATTGAGTTCTTCTCAGACTTTATCACATGATGGAGGATTCTTC
AATAGACTGGAAGATGATGTTCATAAAATTCTTATTAGAGAAAAACGAAGAGAACAGCTTACAGAATATA
ATGGAACAGATAATTGTACAGCTCATGAACACAACCAGGAAGTGGTTCTGAAAGATGGAAGAATTGAAAG
ACTAAAGTTAGAGCTTGAAAGGAAAGATGCTGAAATCCAGAAGCTGAAAAATGTAATCACTCAATGGGAG
GCAAAGTATAAGGAAGTAAAGGCAAGAAATGCACAATTATTGAAAATGCTTCAGGAAGGTGAAATGAAAG
ATAAGGCAGAAATACTTCTGCAAGTTGATGAATCACAAAGTATCAAGAATGAGCTCACTATTCAGGTGAC
TTCACTTCATGCTGCATTAGAACAAGAAAGATCTAAAGTGAAAGTATTACAAGCAGAGTTAGCCAAATAC
CAGGGTGGCAGAAAAGGGAAAAGAAACTCTGAATCCGACCAGTGTAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204911 protein sequence
Red=Cloning site Green=Tags(s)

MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA
NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE
YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFF
NRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWE
AKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKY
QGGRKGKRNSESDQCR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025211
ORF Size 1098 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025211.4
RefSeq Size 1891 bp
RefSeq ORF 1101 bp
Locus ID 80318
UniProt ID Q5VSY0
Cytogenetics 9q21.32
Protein Families Druggable Genome
MW 42.1 kDa
Gene Summary This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Other products for "GKAP1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.