CD99 (NM_002414) Human Tagged ORF Clone

CAT#: RC204056

CD99 (Myc-DDK-tagged)-Human CD99 molecule (CD99), transcript variant 1

Change vector?

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CD99 (NM_002414) Human Tagged ORF Clone
Symbol CD99
Synonyms HBA71; MIC2; MIC2X; MIC2Y; MSK5X
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204056 representing NM_002414
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGCGGGGCTGCGCTGGCGCTGCTGCTCTTCGGCCTGCTGGGTGTTCTGGTCGCCGCCCCGGATG
GTGGTTTCGATTTATCCGATGCCCTTCCTGACAATGAAAACAAGAAACCCACTGCAATCCCCAAGAAACC
CAGTGCTGGGGATGACTTTGACTTAGGAGATGCTGTTGTTGATGGAGAAAATGACGACCCACGACCACCG
AACCCACCCAAACCGATGCCAAATCCAAACCCCAACCACCCTAGTTCCTCCGGTAGCTTTTCAGATGCTG
ACCTTGCGGATGGCGTTTCAGGTGGAGAAGGAAAAGGAGGCAGTGATGGTGGAGGCAGCCACAGGAAAGA
AGGGGAAGAGGCCGACGCCCCAGGCGTGATCCCCGGGATTGTGGGGGCTGTCGTGGTCGCCGTGGCTGGA
GCCATCTCTAGCTTCATTGCTTACCAGAAAAAGAAGCTATGCTTCAAAGAAAATGCAGAACAAGGGGAGG
TGGACATGGAGAGCCACCGGAATGCCAACGCAGAGCCAGCTGTTCAGCGTACTCTTTTAGAGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204056 representing NM_002414
Red=Cloning site Green=Tags(s)

MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP
NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG
AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002414
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002414.1, NM_002414.2, NM_002414.3, NM_002414.4, NP_002405
RefSeq Size 1255
RefSeq ORF 558
Locus ID 4267
Cytogenetics Xp22.33 and Yp11.2
Protein Families Transmembrane, Druggable Genome
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration
MW 18.85 kDa
Gene Summary The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. [provided by RefSeq, Mar 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations