FHL3 (NM_004468) Human Tagged ORF Clone

CAT#: RC203991

Reviews ()
Write a review

FHL3 (Myc-DDK-tagged)-Human four and a half LIM domains 3 (FHL3)



  "NM_004468" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "FHL3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FHL3
Synonyms SLIM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203991 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGAGTCATTTGACTGTGCAAAATGCAACGAGTCCCTGTATGGACGCAAGTACATCCAGACAGACA
GCGGCCCCTACTGTGTGCCCTGCTATGACAATACCTTTGCCAACACCTGTGCTGAGTGCCAGCAGCTTAT
CGGGCATGACTCGAGGGAGCTGTTCTATGAAGACCGCCATTTCCACGAGGGCTGCTTCCGCTGCTGCCGC
TGCCAGCGCTCACTAGCCGATGAACCCTTCACCTGCCAGGACAGTGAGCTGCTCTGCAATGACTGCTACT
GCAGTGCGTTTTCCTCGCAGTGCTCCGCTTGTGGGGAGACTGTCATGCCTGGGTCCCGGAAGCTGGAATA
TGGAGGCCAGACATGGCATGAGCACTGCTTCCTGTGCAGTGGCTGTGAACAGCCACTGGGCTCCCGTTCT
TTTGTGCCCGACAAGGGTGCTCACTACTGCGTGCCCTGCTATGAGAACAAGTTTGCTCCTCGCTGCGCCC
GCTGCAGCAAGACGCTGACACAGGGTGGAGTGACATACCGTGATCAGCCGTGGCATCGAGAATGTCTGGT
CTGTACCGGATGCCAGACGCCCCTGGCAGGGCAGCAGTTCACCTCCCGGGATGAAGATCCCTACTGTGTG
GCCTGTTTTGGAGAACTCTTTGCACCTAAGTGCAGCAGCTGCAAGCGCCCCATCGTAGGACTCGGTGGAG
GCAAGTATGTGTCCTTTGAAGACCGACACTGGCACCACAACTGCTTCTCCTGCGCCCGCTGCTCTACCTC
CCTGGTGGGCCAGGGCTTCGTACCGGATGGAGACCAAGTGCTCTGCCAGGGCTGTAGCCAGGCAGGGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203991 protein sequence
Red=Cloning site Green=Tags(s)

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR
CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS
FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV
ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004468
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004468.5
RefSeq Size 1662 bp
RefSeq ORF 843 bp
Locus ID 2275
UniProt ID Q13643
Cytogenetics 1p34.3
Domains LIM
MW 31.2 kDa
Gene Summary The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.