AIM2 (NM_004833) Human Tagged ORF Clone

CAT#: RC203120

  • TrueORF®

AIM2 (Myc-DDK-tagged)-Human absent in melanoma 2 (AIM2)

 Cited in 1 publication.

  View "NM_004833" in other vectors (10)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AIM2 (NM_004833) Human Tagged ORF Clone
Symbol AIM2
Synonyms PYHIN4
Vector pCMV6-Entry
Sequence Data
>RC203120 representing NM_004833
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGTAAATACAAGGAGATACTCTTGCTAACAGGCCTGGATAACATCACTGATGAGGAACTGGATA
GGTTTAAGTTCTTTCTTTCAGACGAGTTTAATATTGCCACAGGCAAACTACATACTGCAAACAGAATACA
AGTAGCTACCTTGATGATTCAAAATGCTGGGGCGGTGTCTGCAGTGATGAAGACCATTCGTATTTTTCAG
AAGTTGAATTATATGCTTTTGGCAAAACGTCTTCAGGAGGAGAAGGAGAAAGTTGATAAGCAATACAAAT
CGGTAACAAAACCAAAGCCACTAAGTCAAGCTGAAATGAGTCCTGCTGCATCTGCAGCCATCAGAAATGA
TGTCGCAAAGCAACGTGCTGCACCAAAAGTCTCTCCTCATGTTAAGCCTGAACAGAAACAGATGGTGGCC
CAGCAGGAATCTATCAGAGAAGGGTTTCAGAAGCGCTGTTTGCCAGTTATGGTACTGAAAGCAAAGAAGC
CCTTCACGTTTGAGACCCAAGAAGGCAAGCAGGAGATGTTTCATGCTACAGTGGCTACAGAAAAGGAATT
CTTCTTTGTAAAAGTTTTTAATACACTGCTGAAAGATAAATTCATTCCAAAGAGAATAATTATAATAGCA
AGATATTATCGGCACAGTGGTTTCTTAGAGGTAAATAGCGCCTCACGTGTGTTAGATGCTGAATCTGACC
AAAAGGTTAATGTCCCGCTGAACATTATCAGAAAAGCTGGTGAAACCCCGAAGATCAACACGCTTCAAAC
TCAGCCCCTTGGAACAATTGTGAATGGTTTGTTTGTAGTCCAGAAGGTAACAGAAAAGAAGAAAAACATA
TTATTTGACCTAAGTGACAACACTGGGAAAATGGAAGTACTGGGGGTTAGAAACGAGGACACAATGAAAT
GTAAGGAAGGAGATAAGGTTCGACTTACATTCTTCACACTGTCAAAAAATGGAGAAAAACTACAGCTGAC
ATCTGGAGTTCATAGCACCATAAAGGTTATTAAGGCCAAAAAAAAAACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203120 representing NM_004833
Red=Cloning site Green=Tags(s)

MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQ
KLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAKQRAAPKVSPHVKPEQKQMVA
QQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIA
RYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNI
LFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004833
ORF Size 1029 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004833.1, NM_004833.2, NP_004824
RefSeq Size 1485
RefSeq ORF 1032
Locus ID 9447
Cytogenetics 1q23.1-q23.2
Protein Pathways Cytosolic DNA-sensing pathway
MW 38.8 kDa
Gene Summary AIM2 is a member of the IFI20X /IFI16 family. It plays a putative role in tumorigenic reversion and may control cell proliferation. Interferon-gamma induces expression of AIM2. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "AIM2"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies