CES2 (NM_003869) Human Tagged ORF Clone

CAT#: RC203009

Reviews ()
Write a review

CES2 (Myc-DDK-tagged)-Human carboxylesterase 2 (CES2), transcript variant 1



  "NM_003869" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 580.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CES2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CES2
Synonyms CE-2; CES2A1; iCE; PCE-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203009 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGCTCAGTCCCGCTCTCCTACCACACCCACCTTTCCCGGCCCAAGCCAGCGCACCCCGCTGACTC
CCTGCCCAGTCCAAACTCCAAGGCTGGGCAAGGCACTGATCCACTGCTGGACAGACCCGGGGCAGCCTCT
GGGTGAACAGCAGCGTGTCCGCCGGCAGCGAACCGAGACCAGCGAGCCGACCATGCGGCTGCACAGACTT
CGTGCGCGGCTGAGCGCGGTGGCCTGTGGGCTTCTGCTGCTTCTTGTCCGGGGCCAGGGCCAGGACTCAG
CCAGTCCCATCCGGACCACACACACGGGGCAGGTGCTGGGGAGTCTTGTCCATGTGAAGGGCGCCAATGC
CGGGGTCCAAACCTTCCTGGGAATTCCATTTGCCAAGCCACCTCTAGGTCCGCTGCGATTTGCACCCCCT
GAGCCCCCTGAATCTTGGAGTGGTGTGAGGGATGGAACCACCCATCCGGCCATGTGTCTACAGGACCTCA
CCGCAGTGGAGTCAGAGTTTCTTAGCCAGTTCAACATGACCTTCCCTTCCGACTCCATGTCTGAGGACTG
CCTGTACCTCAGCATCTACACGCCGGCCCATAGCCATGAAGGCTCTAACCTGCCGGTGATGGTGTGGATC
CACGGTGGTGCGCTTGTTTTTGGCATGGCTTCCTTGTATGATGGTTCCATGCTGGCTGCCTTGGAGAACG
TGGTGGTGGTCATCATCCAGTACCGCCTGGGTGTCCTGGGCTTCTTCAGCACTGGAGACAAGCACGCAAC
CGGCAACTGGGGCTACCTGGACCAAGTGGCTGCACTACGCTGGGTCCAGCAGAATATCGCCCACTTTGGA
GGCAACCCTGACCGTGTCACCATTTTTGGCGAGTCTGCGGGTGGCACGAGTGTGTCTTCGCTTGTTGTGT
CCCCCATATCCCAAGGACTCTTCCACGGAGCCATCATGGAGAGTGGCGTGGCCCTCCTGCCCGGCCTCAT
TGCCAGCTCAGCTGATGTCATCTCCACGGTGGTGGCCAACCTGTCTGCCTGTGACCAAGTTGACTCTGAG
GCCCTGGTGGGCTGCCTGCGGGGCAAGAGTAAAGAGGAGATTCTTGCAATTAACAAGCCTTTCAAGATGA
TCCCCGGAGTGGTGGATGGGGTCTTCCTGCCCAGGCACCCCCAGGAGCTGCTGGCCTCTGCCGACTTTCA
GCCTGTCCCTAGCATTGTTGGTGTCAACAACAATGAATTCGGCTGGCTCATCCCCAAGGTCATGAGGATC
TATGATACCCAGAAGGAAATGGACAGAGAGGCCTCCCAGGCTGCTCTGCAGAAAATGTTAACGCTGCTGA
TGTTGCCTCCTACATTTGGTGACCTGCTGAGGGAGGAGTACATTGGGGACAATGGGGATCCCCAGACCCT
CCAAGCGCAGTTCCAGGAGATGATGGCGGACTCCATGTTTGTGATCCCTGCACTCCAAGTAGCACATTTT
CAGTGTTCCCGGGCCCCTGTGTACTTCTACGAGTTCCAGCATCAGCCCAGCTGGCTCAAGAACATCAGGC
CACCGCACATGAAGGCAGACCATGGTGATGAGCTTCCTTTTGTTTTCAGAAGTTTCTTTGGGGGCAACTA
CATTAAATTCACTGAGGAAGAGGAGCAGCTAAGCAGGAAGATGATGAAGTACTGGGCCAACTTTGCGAGA
AATGGGAACCCCAATGGCGAGGGTCTGCCACACTGGCCGCTGTTCGACCAGGAGGAGCAATACCTGCAGC
TGAACCTACAGCCTGCGGTGGGCCGGGCTCTGAAGGCCCACAGGCTCCAGTTCTGGAAGAAGGCGCTGCC
CCAAAAGATCCAGGAGCTCGAGGAGCCTGAAGAGAGACACACAGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203009 protein sequence
Red=Cloning site Green=Tags(s)

MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTMRLHRL
RARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPP
EPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWI
HGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFG
GNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSE
ALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI
YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHF
QCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFAR
NGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003869
ORF Size 1869 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003869.5
RefSeq Size 3955 bp
RefSeq ORF 1680 bp
Locus ID 8824
UniProt ID O00748
Cytogenetics 16q22.1
Domains COesterase
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes
MW 68.9 kDa
Gene Summary This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2010]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.