FRAT2 (NM_012083) Human Tagged ORF Clone

CAT#: RC202492

FRAT2 (Myc-DDK-tagged)-Human frequently rearranged in advanced T-cell lymphomas 2 (FRAT2)

Product Images

Circular map for RC202492

• 

  Western blot validation of overexpression lysate (Cat# LY415987) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202492 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: FRAT2
• Synonyms: FRAT-2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202492 representing NM_012083
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCGTGCCGGAGGGAGGAGGAAGAGGAAGCCGGCGAGGAGGCGGAGGGGGAGGAAGAGGAGGACGACA
  GCTTCCTCCTGCTGCAGCAGTCGGTGACGCTGGGCAGCTCGGGCGAGGTGGACCGGCTGGTGGCCCAGAT
  CGGCGAGACGCTGCAGCTGGACGCGGCGCAGGACAGCCCGGCCTCGCCGTGCGCGCCCCCGGGGGTGCCG
  CTGCGGGCCCCGGGGCCCCTGGCTGCGGCGGTGCCGACGGACAAGGCCCGGCCCCCGGCGGTGCCGCTGC
  TGCTGCCGCCCGCTTCGGCTGAGACGGTGGGCCCGGCGCCCTCTGGGGCCCTGCGCTGCGCCCTAGGGGA
  CCGCGGCCGCGTGCGCGGACGCGCTGCGCCCTACTGCGTGGCGGAGGTCGCCGCAGGCCCCAGCGCGCTG
  CCGGGGCCGTGCCGGCGAGGATGGCTCAGGGACGCGGTCACCTCCCGCCGCTTGCAGCAGCGCCGATGGA
  CCCAAGCCGGGGCACGCGCCGGCGACGACGACCCGCATCGGCTCCTCCAGCAGCTCGTGCTCTCGGGAAA
  CCTCATCAAGGAAGCCGTGCGGAGACTCCAACGAGCCGTCGCCGCGGTTGCAGCCACGGGCCCCGCAAGC
  GCCCCTGGGCCCGGGGGAGGCCGCAGCGGACCTGACCGCATTGCCCTGCAGCCCTCAGGCTCCTTGCTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202492 representing NM_012083
  Red=Cloning site Green=Tags(s)
  
  MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVP
  LRAPGPLAAAVPTDKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSAL
  PGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPAS
  APGPGGGRSGPDRIALQPSGSLL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_012083
• ORF Size: 699 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_012083.3
• RefSeq Size: 2222 bp
• RefSeq ORF: 702 bp
• Locus ID: 23401
• UniProt ID: O75474
• Cytogenetics: 10q24.1
• Domains: GSK-3_bind
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS
• Protein Pathways: Wnt signaling pathway
• MW: 23.9 kDa
• Gene Summary: The protein encoded by this intronless gene belongs to the GSK-3-binding protein family. Studies show that this protein plays a role as a positive regulator of the WNT signaling pathway. It may be upregulated in tumor progression. [provided by RefSeq, Jul 2008]