EPHX2 (NM_001979) Human Tagged ORF Clone

CAT#: RC202489

Reviews ()
Write a review

EPHX2 (Myc-DDK-tagged)-Human epoxide hydrolase 2, cytoplasmic (EPHX2)



Reconstitution Protocol

USD 517.00

In Stock*

Size
    • 10 ug

Product images

Other products for "EPHX2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol EPHX2
Synonyms ABHD20; CEH; SEH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202489 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGCTGCGCGCGGCCGTCTTCGACCTTGACGGGGTGCTGGCGCTGCCAGCGGTGTTCGGCGTCCTCG
GCCGCACGGAGGAGGCCCTGGCGCTGCCCAGAGGACTTCTGAATGATGCTTTCCAGAAAGGGGGACCAGA
GGGTGCCACTACCCGGCTTATGAAAGGAGAGATCACACTTTCCCAGTGGATACCACTCATGGAAGAAAAC
TGCAGGAAGTGCTCCGAGACCGCTAAAGTCTGCCTCCCCAAGAATTTCTCCATAAAAGAAATCTTTGACA
AGGCGATTTCAGCCAGAAAGATCAACCGCCCCATGCTCCAGGCAGCTCTCATGCTCAGGAAGAAAGGATT
CACTACTGCCATCCTCACCAACACCTGGCTGGACGACCGTGCTGAGAGAGATGGCCTGGCCCAGCTGATG
TGTGAGCTGAAGATGCACTTTGACTTCCTGATAGAGTCGTGTCAGGTGGGAATGGTCAAACCTGAACCTC
AGATCTACAAGTTTCTGCTGGACACCCTGAAGGCCAGCCCCAGTGAGGTCGTTTTTTTGGATGACATCGG
GGCTAATCTGAAGCCAGCCCGTGACTTGGGAATGGTCACCATCCTGGTCCAGGACACTGACACGGCCCTG
AAAGAACTGGAGAAAGTGACCGGAATCCAGCTTCTCAATACCCCGGCCCCTCTGCCGACCTCTTGCAATC
CAAGTGACATGAGCCATGGGTACGTGACAGTAAAGCCCAGGGTCCGTCTGCATTTTGTGGAGCTGGGCTC
CGGCCCTGCTGTGTGCCTCTGCCATGGATTTCCCGAGAGTTGGTATTCTTGGAGGTACCAGATCCCTGCT
CTGGCCCAGGCAGGTTACCGGGTCCTAGCTATGGACATGAAAGGCTATGGAGAGTCATCTGCTCCTCCCG
AAATAGAAGAATATTGCATGGAAGTGTTATGTAAGGAGATGGTAACCTTCCTGGATAAACTGGGCCTCTC
TCAAGCAGTGTTCATTGGCCATGACTGGGGTGGCATGCTGGTGTGGTACATGGCTCTCTTCTACCCCGAG
AGAGTGAGGGCGGTGGCCAGTTTGAATACTCCCTTCATACCAGCAAATCCCAACATGTCCCCTTTGGAGA
GTATCAAAGCCAACCCAGTATTTGATTACCAGCTCTACTTCCAAGAACCAGGAGTGGCTGAGGCTGAACT
GGAACAGAACCTGAGTCGGACTTTCAAAAGCCTCTTCAGAGCAAGCGATGAGAGTGTTTTATCCATGCAT
AAAGTCTGTGAAGCGGGAGGACTTTTTGTAAATAGCCCAGAAGAGCCCAGCCTCAGCAGGATGGTCACTG
AGGAGGAAATCCAGTTCTATGTGCAGCAGTTCAAGAAGTCTGGTTTCAGAGGTCCTCTAAACTGGTACCG
AAACATGGAAAGGAACTGGAAGTGGGCTTGCAAAAGCTTGGGACGGAAGATCCTGATTCCGGCCCTGATG
GTCACGGCGGAGAAGGACTTCGTGCTCGTTCCTCAGATGTCCCAGCACATGGAGGACTGGATTCCCCACC
TGAAAAGGGGACACATTGAGGACTGTGGGCACTGGACACAGATGGACAAGCCAACCGAGGTGAATCAGAT
CCTCATTAAGTGGCTGGATTCTGATGCCCGGAACCCACCGGTGGTCTCAAAGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202489 protein sequence
Red=Cloning site Green=Tags(s)

MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEEN
CRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLM
CELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTAL
KELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPA
LAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPE
RVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALM
VTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001979
ORF Size 1665 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001979.6
RefSeq Size 2290 bp
RefSeq ORF 1668 bp
Locus ID 2053
UniProt ID P34913
Cytogenetics 8p21.2-p21.1
Domains abhydrolase, Hydrolase
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
MW 62.6 kDa
Gene Summary This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.