XPG (ERCC5) (NM_000123) Human Tagged ORF Clone

CAT#: RC201994

Reviews ()
Write a review

ERCC5 (Myc-DDK-tagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 5 (ERCC5)



Reconstitution Protocol

USD 1,032.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ERCC5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ERCC5
Synonyms COFS3; ERCC5-201; ERCM2; UVDR; XPG; XPGC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201994 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGTCCAGGGGCTCTGGAAGCTGCTGGAGTGCTCCGGGCGGCAGGTCAGCCCCGAAGCGCTGGAAG
GGAAGATCCTGGCTGTTGATATTAGCATTTGGTTAAACCAAGCACTTAAAGGAGTCCGGGATCGCCACGG
GAACTCAATAGAAAATCCTCATCTTCTCACTTTGTTTCATCGGCTCTGCAAACTCTTATTTTTTCGAATT
CGTCCTATTTTTGTGTTTGATGGGGATGCTCCACTATTGAAGAAACAGACTTTGGTGAAGAGAAGGCAGA
GAAAGGACTTAGCGTCCAGTGACTCCAGGAAAACGACAGAGAAGCTTCTGAAAACATTTTTGAAAAGACA
AGCCATCAAAACTGCCTTCAGAAGCAAAAGAGATGAAGCACTACCCAGTCTTACCCAAGTTCGAAGAGAA
AACGACCTCTATGTTTTGCCTCCTTTACAAGAGGAAGAAAAACACAGTTCAGAAGAGGAAGATGAAAAAG
AATGGCAAGAAAGAATGAATCAAAAACAAGCATTACAGGAAGAGTTCTTTCATAATCCTCAAGCGATAGA
TATTGAGTCTGAGGACTTCAGCAGCCTGCCCCCTGAAGTAAAGCATGAAATCTTGACTGATATGAAAGAG
TTCACCAAGCGCAGAAGAACATTATTTGAAGCAATGCCAGAGGAGTCTGATGACTTTTCACAGTACCAAC
TCAAAGGCTTGCTTAAAAAGAACTATCTGAACCAGCATATAGAACATGTCCAAAAGGAAATGAATCAGCA
ACATTCAGGACACATCCGAAGGCAGTATGAAGATGAAGGGGGCTTTCTGAAGGAGGTAGAGTCAAGGAGA
GTGGTCTCTGAAGACACTTCACATTACATCTTGATAAAAGGTATTCAAGCTAAGACAGTTGCAGAAGTGG
ATTCAGAGTCTCTTCCTTCTTCCAGCAAAATGCACGGCATGTCTTTTGACGTGAAGTCATCTCCATGTGA
AAAACTGAAGACAGAGAAAGAGCCTGATGCTACCCCTCCTTCTCCAAGAACTTTACTAGCTATGCAAGCT
GCCCTGCTGGGAAGTAGCTCAGAAGAGGAGCTGGAGAGTGAAAATCGAAGGCAGGCCCGTGGGAGGAACG
CACCTGCTGCTGTAGACGAAGGCTCCATATCACCCCGGACTCTTTCAGCCATTAAGAGAGCTCTTGACGA
TGACGAAGATGTAAAAGTGTGTGCTGGGGATGATGTGCAGACGGGAGGGCCAGGAGCAGAAGAAATGCGT
ATAAACAGCTCCACCGAGAACAGTGATGAAGGACTTAAAGTGAGAGATGGAAAAGGAATACCGTTTACTG
CAACACTTGCGTCATCTAGTGTGAACTCTGCAGAGGAGCACGTAGCCAGCACTAATGAGGGGAGAGAGCC
CACAGACTCAGTTCCAAAAGAACAAATGTCACTTGTTCACGTGGGGACTGAAGCCTTTCCGATAAGTGAT
GAGTCTATGATTAAGGACAGAAAAGATCGGCTGCCTCTGGAGAGTGCAGTGGTTAGACATAGTGACGCAC
CTGGGCTCCCGAATGGAAGGGAACTGACACCGGCATCTCCAACTTGTACAAATTCTGTGTCAAAGAATGA
AACACATGCTGAAGTGCTTGAGCAGCAGAACGAACTTTGCCCATATGAGAGTAAATTCGATTCTTCTCTT
CTTTCAAGTGATGATGAAACAAAATGTAAACCGAATTCTGCTTCTGAAGTCATTGGCCCTGTCAGTTTGC
AAGAAACAAGTAGCATAGTAAGTGTCCCTTCAGAGGCAGTAGATAATGTGGAAAATGTGGTGTCATTTAA
TGCTAAAGAGCATGAGAATTTTCTGGAAACCATCCAAGAACAGCAGACCACTGAATCTGCAGGCCAGGAT
TTAATTTCCATTCCAAAGGCCGTGGAACCAATGGAAATTGACTCGGAAGAAAGTGAATCTGATGGAAGTT
TCATTGAAGTGCAAAGTGTGATTAGTGATGAGGAACTTCAAGCAGAATTCCCTGAAACTTCCAAACCTCC
CTCAGAACAAGGCGAAGAGGAACTGGTAGGAACTAGGGAGGGAGAAGCCCCTGCTGAGTCCGAGAGCCTC
CTGAGGGACAACTCTGAGAGGGACGACGTGGATGGTGAGCCACAGGAAGCTGAGAAAGATGCGGAAGATT
CGCTCCATGAATGGCAAGATATTAATTTGGAGGAGTTGGAAACTCTGGAGAGCAACCTCTTAGCACAGCA
GAATTCACTGAAAGCTCAAAAACAGCAGCAAGAACGGATCGCTGCTACTGTCACCGGACAGATGTTCCTG
GAAAGCCAGGAACTCCTGCGCCTGTTCGGCATTCCCTACATCCAGGCTCCCATGGAAGCAGAGGCGCAGT
GCGCCATCCTGGACCTGACTGATCAGACTTCCGGAACCATCACTGATGACAGTGATATCTGGCTGTTTGG
AGCGCGGCATGTCTATAGAAACTTTTTTAATAAAAACAAGTTTGTAGAATATTATCAATATGTGGACTTT
CACAATCAATTGGGATTGGACCGGAATAAGTTAATAAATTTGGCTTATTTGCTTGGAAGTGATTATACCG
AAGGAATACCAACTGTGGGTTGTGTAACCGCCATGGAAATTCTCAATGAATTCCCTGGGCATGGCCTGGA
ACCTCTCCTAAAATTCTCAGAATGGTGGCATGAAGCTCAAAAAAATCCAAAGATAAGACCTAATCCTCAT
GACACCAAAGTGAAAAAAAAATTACGGACATTGCAACTCACCCCTGGCTTTCCTAACCCAGCTGTTGCCG
AGGCCTACCTCAAACCCGTGGTGGATGACTCGAAGGGATCCTTTCTGTGGGGGAAACCTGATCTCGACAA
AATTAGAGAATTTTGTCAGCGGTATTTCGGCTGGAACAGAACGAAGACAGATGAATCTCTGTTTCCTGTA
TTAAAGCAACTCGATGCCCAGCAGACACAGCTCCGAATTGATTCCTTCTTTAGATTAGCACAACAGGAGA
AAGAAGATGCTAAACGTATTAAGAGCCAGAGACTAAACAGAGCTGTGACATGTATGCTAAGGAAAGAGAA
AGAAGCAGCAGCCAGCGAAATAGAAGCAGTTTCTGTTGCCATGGAGAAAGAATTTGAGCTACTTGATAAG
GCAAAACGAAAAACCCAGAAGAGAGGCATAACAAATACCTTAGAAGAGTCATCAAGCCTGAAAAGAAAGA
GGCTTTCAGATTCTAAACGAAAGAATACATGCGGTGGATTTTTGGGGGAGACCTGCCTCTCAGAATCATC
TGATGGATCTTCAAGTGAAGATGCTGAAAGTTCATCTTTAATGAATGTACAAAGGAGAACAGCTGCGAAA
GAGCCAAAAACCAGTGCTTCAGATTCGCAGAACTCAGTGAAGGAAGCTCCCGTGAAGAATGGAGGTGCGA
CCACCAGCAGCTCTAGTGATAGTGATGACGATGGAGGGAAAGAGAAGATGGTCCTCGTGACCGCCAGATC
TGTGTTTGGGAAGAAAAGAAGGAAACTAAGACGTGCGAGGGGAAGAAAAAGGAAAACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201994 protein sequence
Red=Cloning site Green=Tags(s)

MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFHRLCKLLFFRI
RPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIKTAFRSKRDEALPSLTQVRRE
NDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFFHNPQAIDIESEDFSSLPPEVKHEILTDMKE
FTKRRRTLFEAMPEESDDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRR
VVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQA
ALLGSSSEEELESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR
INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVHVGTEAFPISD
ESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHAEVLEQQNELCPYESKFDSSL
LSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNVENVVSFNAKEHENFLETIQEQQTTESAGQD
LISIPKAVEPMEIDSEESESDGSFIEVQSVISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESL
LRDNSERDDVDGEPQEAEKDAEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFL
ESQELLRLFGIPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF
HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQKNPKIRPNPH
DTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPV
LKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDK
AKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAK
EPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000123
ORF Size 3558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000123.4
RefSeq Size 4091 bp
RefSeq ORF 3561 bp
Locus ID 2073
UniProt ID P28715
Cytogenetics 13q33.1
Domains HhH2, XPG_N, XPG_I
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Nucleotide excision repair
MW 133.3 kDa
Gene Summary This gene encodes a single-strand specific DNA endonuclease that makes the 3' incision in DNA excision repair following UV-induced damage. The protein may also function in other cellular processes, including RNA polymerase II transcription, and transcription-coupled DNA repair. Mutations in this gene cause xeroderma pigmentosum complementation group G (XP-G), which is also referred to as xeroderma pigmentosum VII (XP7), a skin disorder characterized by hypersensitivity to UV light and increased susceptibility for skin cancer development following UV exposure. Some patients also develop Cockayne syndrome, which is characterized by severe growth defects, cognitive disability, and cachexia. Read-through transcription exists between this gene and the neighboring upstream BIVM (basic, immunoglobulin-like variable motif containing) gene. [provided by RefSeq, Feb 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.