DDX41 (NM_016222) Human Tagged ORF Clone

CAT#: RC201898

DDX41 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 (DDX41)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name DDX41 (NM_016222) Human Tagged ORF Clone
Symbol DDX41
Synonyms ABS
Vector pCMV6-Entry
Sequence Data
>RC201898 representing NM_016222
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGTCGGAACCCGAACGGAAGCGGGCTCGCACCGACGAGGTGCCTGCCGGAGGAAGCCGCTCCG
AGGCGGAAGATGAGGACGACGAGGACTACGTGCCCTATGTGCCGTTACGGCAGCGCCGGCAGCTACTGCT
CCAGAAGCTGCTGCAGCGAAGACGCAAGGGAGCTGCGGAGGAAGAGCAGCAGGACAGCGGTAGTGAACCC
CGGGGAGATGAGGACGACATCCCGCTAGGCCCTCAGTCCAACGTCAGCCTCCTGGATCAGCACCAGCACC
TTAAAGAGAAGGCTGAAGCGCGCAAAGAGTCTGCCAAGGAGAAGCAGCTGAAGGAAGAAGAGAAGATCCT
GGAGAGTGTTGCCGAGGGCCGAGCATTGATGTCAGTGAAGGAGATGGCTAAGGGCATTACGTATGATGAC
CCCATCAAAACCAGCTGGACTCCACCCCGTTATGTTCTGAGCATGTCTGAAGAGCGACATGAGCGCGTGC
GGAAGAAATACCACATCCTGGTGGAGGGAGACGGTATCCCACCACCCATCAAGAGCTTCAAGGAAATGAA
GTTTCCTGCAGCCATCCTGAGAGGCCTGAAGAAGAAAGGCATTCACCACCCAACACCCATTCAGATCCAG
GGCATCCCCACCATTCTATCTGGCCGTGACATGATAGGCATCGCTTTCACGGGTTCAGGCAAGACACTGG
TGTTCACGTTGCCCGTCATCATGTTCTGCCTGGAACAAGAGAAGAGGTTACCCTTCTCAAAGCGCGAGGG
GCCCTATGGACTCATCATCTGCCCCTCGCGGGAGCTGGCCCGGCAGACCCATGGCATCCTGGAGTACTAC
TGCCGCCTGCTGCAGGAGGACAGCTCACCACTCCTGCGCTGCGCCCTCTGCATTGGGGGCATGTCCGTGA
AAGAGCAGATGGAGACCATCCGACACGGTGTACACATGATGGTGGCCACCCCGGGGCGCCTCATGGATTT
GCTGCAGAAGAAGATGGTCAGCCTAGACATCTGTCGCTACCTGGCCCTGGACGAGGCTGACCGCATGATC
GACATGGGCTTCGAGGGTGACATCCGTACCATCTTCTCCTACTTCAAGGGCCAGCGACAGACCCTGCTCT
TCAGTGCCACCATGCCGAAGAAGATTCAGAACTTTGCTAAGAGTGCCCTTGTAAAGCCTGTGACCATCAA
TGTGGGGCGCGCTGGGGCTGCCAGCCTGGATGTCATCCAGGAGGTAGAATATGTGAAGGAGGAGGCCAAG
ATGGTGTACCTGCTCGAGTGCCTGCAGAAGACACCCCCGCCTGTACTCATCTTTGCAGAGAAGAAGGCAG
ACGTGGACGCCATCCACGAGTACCTGCTGCTCAAGGGGGTTGAGGCCGTAGCCATCCATGGGGGCAAAGA
CCAGGAGGAACGGACTAAGGCCATCGAGGCATTCCGGGAGGGCAAGAAGGATGTCCTAGTAGCCACAGAC
GTTGCCTCCAAGGGCCTGGACTTCCCTGCCATCCAGCACGTCATCAATTATGACATGCCAGAGGAGATTG
AGAACTATGTACACCGGATTGGCCGCACCGGGCGCTCGGGAAACACAGGCATCGCCACTACCTTCATCAA
CAAAGCGTGTGATGAGTCAGTGCTGATGGACCTCAAAGCGCTGCTGCTAGAAGCCAAGCAGAAGGTGCCG
CCCGTGCTGCAGGTGCTGCATTGCGGGGATGAGTCCATGCTGGACATTGGAGGAGAGCGCGGCTGTGCCT
TCTGCGGGGGCCTGGGTCATCGGATCACTGACTGCCCCAAACTCGAGGCTATGCAGACCAAGCAGGTCAG
CAACATCGGTCGCAAGGACTACCTGGCCCACAGCTCCATGGACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201898 representing NM_016222
Red=Cloning site Green=Tags(s)

MEESEPERKRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEP
RGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDD
PIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQ
GIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYY
CRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMI
DMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAK
MVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATD
VASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVP
PVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016222
ORF Size 1866 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016222.1, NM_016222.2, NM_016222.3, NP_057306
RefSeq Size 2118
RefSeq ORF 1869
Locus ID 51428
Cytogenetics 5q35.3
Domains DEAD, helicase_C, zf-CCHC
Protein Families Druggable Genome
MW 69.7 kDa
Gene Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD box protein family and interacts with several spliceosomal proteins. In addition, the encoded protein may recognize the bacterial second messengers cyclic di-GMP and cyclic di-AMP, resulting in the induction of genes involved in the innate immune response. [provided by RefSeq, Jan 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)