BASP1 (NM_006317) Human Tagged ORF Clone

CAT#: RC201815

Reviews ()
Write a review

BASP1 (Myc-DDK-tagged)-Human brain abundant, membrane attached signal protein 1 (BASP1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BASP1
Synonyms CAP-23; CAP23; NAP-22; NAP22
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201815 representing NM_006317
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGGCAAGCTCAGCAAGAAGAAGAAGGGCTACAATGTGAACGACGAGAAAGCCAAGGAGAAAGACA
AGAAGGCCGAGGGCGCGGCGACGGAAGAGGAGGGGACCCCGAAGGAGAGTGAGCCCCAGGCGGCCGCAGA
GCCCGCCGAGGCCAAGGAGGGCAAGGAGAAGCCCGACCAGGACGCCGAGGGCAAGGCCGAGGAGAAGGAG
GGCGAGAAGGACGCGGCGGCTGCCAAGGAGGAGGCCCCGAAGGCGGAGCCCGAGAAGACGGAGGGCGCGG
CAGAGGCCAAGGCTGAGCCCCCGAAGGCGCCCGAGCAGGAGCAGGCGGCCCCCGGCCCCGCTGCGGGCGG
CGAGGCCCCCAAAGCTGCTGAGGCCGCCGCGGCCCCGGCCGAGAGCGCGGCCCCTGCCGCCGGGGAGGAG
CCCAGCAAGGAGGAAGGGGAACCCAAAAAGACTGAGGCGCCCGCAGCTCCTGCCGCCCAGGAGACCAAAA
GTGACGGGGCCCCAGCTTCAGACTCAAAACCCGGCAGCTCGGAGGCTGCCCCCTCTTCCAAGGAGACCCC
CGCAGCCACGGAAGCGCCTAGTTCCACACCCAAGGCCCAGGGCCCCGCAGCCTCTGCAGAAGAGCCCAAG
CCGGTGGAGGCCCCGGCAGCTAATTCCGACCAAACCGTAACCGTGAAAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201815 representing NM_006317
Red=Cloning site Green=Tags(s)

MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKE
GEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEE
PSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPK
PVEAPAANSDQTVTVKE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006317
ORF Size 681 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006317.5
RefSeq Size 1820 bp
RefSeq ORF 684 bp
Locus ID 10409
UniProt ID P80723
Cytogenetics 5p15.1
MW 22.5 kDa
Gene Summary This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2012]
Other products for "BASP1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.