Adrenodoxin (FDX1) (NM_004109) Human Tagged ORF Clone

CAT#: RC201647

FDX1 (Myc-DDK-tagged)-Human ferredoxin 1 (FDX1), nuclear gene encoding mitochondrial protein

Product Images

Circular map for RC201647

• 

  Western blot validation of overexpression lysate (Cat# LY401330) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201647 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified FDX1 protein (Cat# TP301647). The protein was produced from HEK293T cells transfected with FDX1 cDNA clone (Cat# RC201647) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Adrenodoxin
• Synonyms: ADX; FDX; LOH11CR1D
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201647 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGCCGCTGGGGGCGCCCGGCTGCTGCGCGCCGCTTCTGCTGTCCTCGGCGGCCCGGCCGGCCGGT
  GGCTGCACCACGCTGGGTCCCGCGCTGGATCCAGCGGCCTGCTGAGGAACCGGGGGCCGGGCGGGAGCGC
  GGAGGCGAGCCGGTCGCTGAGCGTGTCGGCGCGGGCCCGGAGCAGCTCAGAAGATAAAATAACAGTCCAC
  TTTATAAACCGTGATGGTGAAACATTAACAACCAAAGGAAAAGTTGGTGATTCTCTGCTAGATGTTGTGG
  TTGAAAATAATCTAGATATTGATGGCTTTGGTGCATGTGAGGGAACCCTGGCTTGTTCAACCTGTCACCT
  CATCTTTGAAGATCACATATATGAGAAGTTAGATGCAATCACTGATGAGGAGAATGACATGCTCGATCTG
  GCATATGGACTAACAGACAGATCACGGTTGGGCTGCCAAATCTGTTTGACAAAATCTATGGACAATATGA
  CTGTTCGAGTGCCTGAAACAGTGGCTGATGCCAGACAATCCATTGATGTGGGCAAGACCTCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201647 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH
  FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL
  AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_004109
• ORF Size: 552 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_004109.5
• RefSeq Size: 3155 bp
• RefSeq ORF: 555 bp
• Locus ID: 2230
• UniProt ID: P10109
• Cytogenetics: 11q22.3
• Domains: fer2
• MW: 19.4 kDa
• Gene Summary: This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011]