CoCoA (CALCOCO1) (NM_020898) Human Tagged ORF Clone

CAT#: RC201375

Reviews ()
Write a review

CALCOCO1 (Myc-DDK-tagged)-Human calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 1



  "NM_020898" in other vectors (4)

Reconstitution Protocol

USD 633.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CALCOCO1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CALCOCO1
Synonyms calphoglin; Cocoa; PP13275
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201375 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGAATCACCACTAAGCCGGGCACCATCCCGTGGTGGAGTCAACTTTCTCAATGTAGCCCGGACCT
ACATCCCCAACACCAAGGTGGAATGTCACTACACCCTTCCCCCAGGCACCATGCCCAGTGCCAGTGACTG
GATTGGCATCTTCAAGGTGGAGGCTGCCTGTGTTCGGGATTACCACACATTTGTGTGGTCTTCCGTGCCT
GAAAGTACAACTGATGGTTCCCCCATTCACACCAGTGTCCAGTTCCAAGCCAGCTACCTGCCCAAACCAG
GAGCTCAGCTCTACCAGTTCCGATATGTGAACCGCCAGGGCCAGGTGTGTGGGCAGAGCCCCCCTTTCCA
GTTCCGAGAGCCAAGGCCCATGGATGAACTGGTGACCCTGGAGGAGGCTGATGGGGGCTCTGACATCCTG
CTGGTTGTCCCCAAGGCAACTGTGTTACAGAACCAGCTCGATGAGAGCCAGCAAGAACGGAATGACCTGA
TGCAGCTGAAGCTACAGCTGGAGGGACAGGTGACAGAGCTGAGGAGCCGAGTGCAGGAGCTCGAGAGGGC
TCTGGCAACTGCCAGGCAGGAGCACACGGAGCTGATGGAACAGTACAAGGGGATTTCCCGGTCCCATGGG
GAGATCACAGAAGAGAGGGACATCCTGAGCCGGCAACAGGGAGACCATGTGGCACGCATCCTGGAGCTAG
AGGATGACATCCAGACCATCAGTGAGAAAGTGCTGACGAAGGAAGTGGAGCTGGACAGGCTTAGAGACAC
AGTGAAGGCCCTGACTCGGGAACAAGAGAAGCTCCTTGGGCAACTGAAAGAAGTACAAGCAGACAAGGAG
CAAAGTGAGGCTGAGCTCCAAGTGGCACAACAGGAGAACCATCACTTAAATTTGGACCTGAAGGAGGCGA
AGAGCTGGCAAGAGGAGCAGAGTGCTCAGGCTCAGCGACTGAAAGACAAGGTGGCCCAGATGAAGGACAC
CCTAGGCCAGGCCCAGCAGCGGGTGGCCGAGCTGGAGCCCTTGAAGGAGCAGCTTCGAGGGGCCCAGGAG
CTTGCAGCCTCAAGCCAGCAGAAAGCCACCCTTCTTGGGGAGGAGTTGGCCAGTGCAGCAGCAGCCAGGG
ACCGCACCATAGCCGAACTACACCGCAGCCGCCTGGAAGTGGCTGAAGTTAACGGCAGGCTGGCTGAGCT
CGGTTTGCACTTGAAGGAAGAAAAATGCCAATGGAGCAAGGAGCGGGCAGGGCTGCTGCAGAGTGTGGAG
GCAGAGAAGGACAAGATCCTGAAGCTGAGTGCAGAGATACTTCGATTGGAGAAGGCAGTTCAGGAGGAGA
GGACCCAAAACCAAGTGTTCAAGACTGAGCTGGCCCGGGAGAAGGATTCTAGCCTGGTACAGTTGTCAGA
AAGTAAGCGGGAGCTGACAGAGCTGCGGTCAGCCCTGCGTGTGCTCCAGAAGGAAAAGGAGCAGTTACAG
GAGGAGAAACAGGAATTGCTAGAGTACATGAGAAAGCTAGAGGCCCGCCTGGAGAAGGTGGCAGATGAGA
AGTGGAATGAGGATGCCACCACAGAGGATGAGGAGGCCGCTGTGGGGCTGAGCTGCCCGGCAGCTCTGAC
AGACTCAGAGGACGAGTCCCCAGAAGACATGAGGCTCCCACCCTATGGCCTTTGTGAGCGTGGAGACCCA
GGCTCCTCTCCTGCTGGGCCTCGAGAGGCTTCTCCCCTTGTTGTCATCAGCCAGCCGGCTCCCATTTCTC
CTCACCTCTCTGGGCCAGCTGAGGACAGTAGCTCTGACTCGGAGGCTGAAGATGAGAAGTCAGTCCTGAT
GGCAGCTGTGCAGAGTGGGGGTGAGGAGGCCAACTTACTGCTTCCTGAACTGGGCAGTGCCTTCTATGAC
ATGGCCAGTGGCTTTACAGTGGGTACCCTGTCAGAAACCAGCACTGGGGGCCCTGCCACCCCCACATGGA
AGGAGTGTCCTATCTGTAAGGAGCGCTTTCCTGCTGAGAGTGACAAGGATGCCCTGGAGGACCACATGGA
TGGACACTTCTTTTTCAGCACCCAGGACCCCTTCACCTTTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201375 protein sequence
Red=Cloning site Green=Tags(s)

MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYHTFVWSSVP
ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPMDELVTLEEADGGSDIL
LVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSRVQELERALATARQEHTELMEQYKGISRSHG
EITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKE
QSEAELQVAQQENHHLNLDLKEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQE
LAASSQQKATLLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQ
EEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSEDESPEDMRLPPYGLCERGDP
GSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEKSVLMAAVQSGGEEANLLLPELGSAFYD
MASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020898
ORF Size 2073 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020898.3
RefSeq Size 3046 bp
RefSeq ORF 2076 bp
Locus ID 57658
UniProt ID Q9P1Z2
Cytogenetics 12q13.13
Protein Families Transcription Factors
MW 77.3 kDa
Gene Summary Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions (By similarity). In association with CCAR1 enhances GATA1- and MED1-mediated transcriptional activation from the gamma-globin promoter during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.