EIF4EBP1 (NM_004095) Human Tagged ORF Clone
CAT#: RC201348
EIF4EBP1 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_004095" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | EIF4EBP1 |
Synonyms | 4E-BP1; 4EBP1; BP-1; PHAS-I |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201348 representing NM_004095
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGGGGGCAGCAGCTGCAGCCAGACCCCAAGCCGGGCCATCCCCGCCACTCGCCGGGTGGTGCTCG GCGACGGCGTGCAGCTCCCGCCCGGGGACTACAGCACGACCCCCGGCGGCACGCTCTTCAGCACCACCCC GGGAGGTACCAGGATCATCTATGACCGGAAATTCCTGATGGAGTGTCGGAACTCACCTGTGACCAAAACA CCCCCAAGGGATCTGCCCACCATTCCGGGGGTCACCAGCCCTTCCAGTGATGAGCCCCCCATGGAAGCCA GCCAGAGCCACCTGCGCAATAGCCCAGAAGATAAGCGGGCGGGCGGTGAAGAGTCACAGTTTGAGATGGA CATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201348 representing NM_004095
Red=Cloning site Green=Tags(s) MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKT PPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_004095 |
ORF Size | 354 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_004095.4 |
RefSeq Size | 895 bp |
RefSeq ORF | 357 bp |
Locus ID | 1978 |
UniProt ID | Q13541 |
Cytogenetics | 8p11.23 |
Protein Pathways | Acute myeloid leukemia, ErbB signaling pathway, Insulin signaling pathway, mTOR signaling pathway |
MW | 12.4 kDa |
Gene Summary | This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201348L1 | Lenti ORF clone of Human eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1), Myc-DDK-tagged |
USD 525.00 |
|
RC201348L2 | Lenti ORF clone of Human eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1), mGFP tagged |
USD 525.00 |
|
RC201348L3 | Lenti ORF clone of Human eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1), Myc-DDK-tagged |
USD 525.00 |
|
RC201348L4 | Lenti ORF clone of Human eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1), mGFP tagged |
USD 525.00 |
|
RG201348 | EIF4EBP1 (tGFP-tagged) - Human eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1) |
USD 425.00 |
|
SC122669 | EIF4EBP1 (untagged)-Human eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1) |
USD 225.00 |
{0} Product Review(s)
Be the first one to submit a review