RFX3 (NM_134428) Human Tagged ORF Clone

CAT#: RC201137

Reviews ()
Write a review

RFX3 (Myc-DDK-tagged)-Human regulatory factor X, 3 (influences HLA class II expression) (RFX3), transcript variant 2



Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RFX3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RFX3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201137 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGACATCAGAGACTGGGTCGGACACAGGCTCGACAGTGACCTTACAAACATCTGTGGCTAGTCAAG
CAGCAGTGCCTACGCAGGTGGTACAGCAAGTACCAGTACAACAACAGGTACAGCAGGTACAGACTGTGCA
GCAGGTACAACATGTCTATCCCGCTCAGGTGCAGTATGTGGAAGGAAGCGATACTGTCTATACCAATGGA
GCAATCCGAACAACAACGTATCCTTACACAGAGACACAGATGTACAGCCAAAATACTGGAGGGAATTACT
TTGATACTCAAGGGAGTTCCGCCCAGGTGACTACCGTGGTCTCATCCCACAGTATGGTGGGCACTGGTGG
GATTCAGATGGGCGTCACAGGAGGACAACTCATCAGCAGCTCTGGAGGAACCTATCTGATCGGCAACTCA
ATGGAGAATTCTGGTCACTCAGTGACACACACAACTCGGGCCTCCCCAGCGACAATTGAAATGGCGATTG
AGACGCTGCAAAAGTCTGACGGTCTGTCCACTCACAGAAGCTCTCTTCTCAACAGCCATCTCCAGTGGCT
GTTGGACAATTATGAGACAGCAGAAGGAGTGAGCCTTCCCAGAAGCACTCTGTACAACCACTACCTTCGA
CACTGTCAGGAACACAAACTGGACCCAGTCAATGCTGCCTCTTTTGGAAAATTAATAAGATCAATTTTTA
TGGGGCTACGAACCAGGAGATTGGGCACTAGAGGAAACTCCAAATACCACTACTATGGGATTCGTGTCAA
GCCAGATTCCCCTCTTAATCGTCTGCAAGAAGACATGCAGTATATGGCTATGAGACAACAACCCATGCAA
CAGAAACAAAGGTACAAGCCTATGCAGAAAGTGGATGGGGTTGCAGATGGTTTCACAGGAAGTGGTCAAC
AGACAGGCACATCTGTTGAGCAAACTGTAATTGCCCAAAGCCAACATCATCAACAGTTTTTAGATGCATC
TCGAGCACTTCCAGAGTTTGGAGAAGTTGAAATCTCTTCTCTGCCAGATGGTACTACCTTTGAGGATATC
AAGTCACTGCAGAGTCTTTATAGAGAGCACTGTGAGGCAATATTGGACGTTGTTGTGAATCTTCAATTTA
GCCTGATAGAAAAATTGTGGCAAACATTCTGGCGCTATTCTCCCTCTACTCCAACTGATGGCACTACCAT
TACCGAATCGAGCAATCTGAGTGAAATAGAAAGTCGACTTCCGAAAGCAAAGCTGATAACTCTGTGCAAA
CATGAGTCTATCCTGAAATGGATGTGTAACTGTGACCATGGGATGTACCAGGCTTTGGTGGAGATTCTCA
TCCCCGACGTCCTTAGACCTATTCCTAGTGCCTTGACCCAAGCCATTCGAAATTTTGCAAAAAGCCTTGA
AGGTTGGCTTTCCAATGCCATGAACAATATTCCACAGAGAATGATACAAACCAAGGTTGCCGCTGTAAGT
GCCTTTGCCCAGACTCTGCGAAGATACACGTCGCTTAATCACCTGGCCCAGGCAGCTCGTGCAGTGCTTC
AGAACACTTCCCAAATCAACCAGATGCTTAGTGACCTCAACCGTGTCGACTTTGCCAATGTCCAGGAGCA
GGCTTCCTGGGTGTGCCAGTGTGATGACAACATGGTTCAGAGACTAGAAACAGACTTCAAGATGACTCTT
CAGCAGCAGAGCACCCTGGAGCAGTGGGCTGCGTGGCTTGACAATGTGATGATGCAAGCACTGAAACCCT
ATGAAGGAAGACCCAGTTTTCCTAAAGCCGCCAGGCAGTTTCTGCTAAAATGGTCTTTCTACAGCTCAAT
GGTTATTCGGGACTTAACCTTACGCAGTGCTGCTAGCTTTGGCTCCTTCCACCTGATCCGTCTACTCTAC
GACGAATATATGTTTTACTTAGTAGAACATCGTGTTGCTCAGGCAACAGGAGAGACTCCTATAGCAGTCA
TGGGCGAGTTTGGTGATTTAAATGCCGTGTCTCCTGGAAATCTGGATAAAGATGAAGGCAGTGAAGTAGA
AAGTGAAATGGATGAAGAACTGGATGACTCTTCAGAGCCTCAAGCCAAAAGAGAGAAAACAGAGCTGAGC
CAGGCATTTCCAGTGGGCTGCATGCAGCCTGTTCTCGAGACTGGCGTGCAACCAAGCCTCCTGAATCCAA
TTCACAGCGAGCACATTGTCACAAGTACTCAGACTATCAGACAGTGCAGCGCTACAGGAAATACCTACAC
TGCAGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201137 protein sequence
Red=Cloning site Green=Tags(s)

MQTSETGSDTGSTVTLQTSVASQAAVPTQVVQQVPVQQQVQQVQTVQQVQHVYPAQVQYVEGSDTVYTNG
AIRTTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQMGVTGGQLISSSGGTYLIGNS
MENSGHSVTHTTRASPATIEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLR
HCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQPMQ
QKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDI
KSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPTDGTTITESSNLSEIESRLPKAKLITLCK
HESILKWMCNCDHGMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLSNAMNNIPQRMIQTKVAAVS
AFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCDDNMVQRLETDFKMTL
QQQSTLEQWAAWLDNVMMQALKPYEGRPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLY
DEYMFYLVEHRVAQATGETPIAVMGEFGDLNAVSPGNLDKDEGSEVESEMDEELDDSSEPQAKREKTELS
QAFPVGCMQPVLETGVQPSLLNPIHSEHIVTSTQTIRQCSATGNTYTAV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_134428
ORF Size 2247 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_134428.3
RefSeq Size 9338 bp
RefSeq ORF 2250 bp
Locus ID 5991
UniProt ID P48380
Cytogenetics 9p24.2
Domains RFX_DNA_binding, RFX1_trans_act
Protein Families Transcription Factors
MW 83.5 kDa
Gene Summary This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.