CIKS (TRAF3IP2) (NM_147686) Human Tagged ORF Clone

CAT#: RC201106

Reviews ()
Write a review

TRAF3IP2 (Myc-DDK-tagged)-Human TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2



  "NM_147686" in other vectors (6)

Reconstitution Protocol

USD 526.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TRAF3IP2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRAF3IP2
Synonyms ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201106 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCGAAGCATTCCTGTGGAGGTTGATGAATCAGAACCATACCCAAGTCAGTTGCTGAAACCAATCC
CAGAATATTCCCCGGAAGAGGAATCAGAACCACCTGCTCCAAATATAAGGAACATGGCACCCAACAGCTT
GTCTGCACCCACAATGCTTCACAATTCCTCCGGAGACTTTTCTCAAGCTCACTCAACCCTGAAACTTGCA
AATCACCAGCGGCCTGTATCCCGGCAGGTCACCTGCCTGCGCACTCAAGTTCTGGAGGACAGTGAAGACA
GTTTCTGCAGGAGACACCCAGGCCTGGGCAAAGCTTTCCCTTCTGGGTGCTCTGCAGTCAGCGAGCCTGC
GTCTGAGTCTGTGGTTGGAGCCCTCCCTGCAGAGCATCAGTTTTCATTTATGGAAAAACGTAATCAATGG
CTGGTATCTCAGCTTTCAGCGGCTTCTCCTGACACTGGCCATGACTCAGACAAATCAGACCAAAGTTTAC
CTAATGCCTCAGCAGACTCCTTGGGCGGTAGCCAGGAGATGGTGCAACGGCCCCAGCCTCACAGGAACCG
AGCAGGCCTGGATCTGCCAACCATAGACACGGGATATGATTCCCAGCCCCAGGATGTCCTGGGCATCAGG
CAGCTGGAAAGGCCCCTGCCCCTCACCTCCGTGTGTTACCCCCAGGACCTCCCCAGACCTCTCAGGTCCA
GGGAGTTCCCTCAGTTTGAACCTCAGAGGTATCCAGCATGTGCACAGATGCTGCCTCCCAATCTTTCCCC
ACATGCTCCATGGAACTATCATTACCATTGTCCTGGAAGTCCCGATCACCAGGTGCCATATGGCCATGAC
TACCCTCGAGCAGCCTACCAGCAAGTGATCCAGCCGGCTCTGCCTGGGCAGCCCCTGCCTGGAGCCAGTG
TGAGAGGCCTGCACCCTGTGCAGAAGGTTATCCTGAATTATCCCAGCCCCTGGGACCAAGAAGAGAGGCC
CGCACAGAGAGACTGCTCCTTTCCGGGGCTTCCAAGGCACCAGGACCAGCCACATCACCAGCCACCTAAT
AGAGCTGGTGCTCCTGGGGAGTCCTTGGAGTGCCCTGCAGAGCTGAGACCACAGGTTCCCCAGCCTCCGT
CCCCAGCTGCTGTGCCTAGACCCCCTAGCAACCCTCCAGCCAGAGGAACTCTAAAAACAAGCAATTTGCC
AGAAGAATTGCGGAAAGTCTTTATCACTTATTCGATGGACACAGCTATGGAGGTGGTGAAATTCGTGAAC
TTTTTGTTGGTAAATGGCTTCCAAACTGCAATTGACATATTTGAGGATAGAATCCGAGGCATTGATATCA
TTAAATGGATGGAGCGCTACCTTAGGGATAAGACCGTGATGATAATCGTAGCAATCAGCCCCAAATACAA
ACAGGACGTGGAAGGCGCTGAGTCGCAGCTGGACGAGGATGAGCATGGCTTACATACTAAGTACATTCAT
CGAATGATGCAGATTGAGTTCATAAAACAAGGAAGCATGAATTTCAGATTCATCCCTGTGCTCTTCCCAA
ATGCTAAGAAGGAGCATGTGCCCACCTGGCTTCAGAACACTCATGTCTACAGCTGGCCCAAGAATAAAAA
AAACATCCTGCTGCGGCTGCTGAGAGAGGAAGAGTATGTGGCTCCTCCACGGGGGCCTCTGCCCACCCTT
CAGGTGGTTCCCTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201106 protein sequence
Red=Cloning site Green=Tags(s)

MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLA
NHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQW
LVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIR
QLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHD
YPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN
RAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVN
FLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIH
RMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTL
QVVPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_147686
ORF Size 1695 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_147686.1, NP_679211.1
RefSeq Size 6244 bp
RefSeq ORF 1698 bp
Locus ID 10758
UniProt ID O43734
Cytogenetics 6q21
MW 63.6 kDa
Gene Summary This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene. [provided by RefSeq, Aug 2009]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.