RNF40 (NM_014771) Human Tagged ORF Clone

CAT#: RC200575

Reviews ()
Write a review

RNF40 (Myc-DDK-tagged)-Human ring finger protein 40 (RNF40), transcript variant 1



  "NM_014771" in other vectors (7)

Reconstitution Protocol

USD 871.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "RNF40"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RNF40
Synonyms BRE1B; RBP95; STARING
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200575 representing NM_014771
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGGCCAGGCAACAAACGCGCCGCCGGCGACGGGGGCTCAGGGCCCCCGGAAAAGAAGCTGAGTC
GTGAGGAGAAGACCACCACGACTCTTATCGAGCCCATTCGTCTTGGAGGCATCTCTTCCACGGAGGAGAT
GGACCTGAAGGTACTACAGTTCAAGAACAAGAAACTGGCAGAGCGGCTGGAACAACGGCAGGCTTGTGAA
GATGAACTCCGAGAACGAATTGAGAAGTTGGAGAAGCGGCAGGCCACAGATGATGCCACACTCCTCATCG
TCAATCGCTACTGGGCCCAGCTGGATGAAACTGTGGAAGCCCTTCTCCGATGCCATGAGAGCCAGGGGGA
GCTGTCTTCAGCGCCTGAGGCACCTGGGACCCAGGAGGGGCCAACATGTGATGGGACTCCTCTCCCAGAG
CCGGGGACATCAGAGCTGAGAGACCCCTTGCTGATGCAGCTGCGGCCCCCTCTCAGTGAGCCGGCCTTGG
CTTTTGTGGTGGCACTGGGTGCCAGCAGCAGTGAGGAGGTGGAGCTGGAGCTGCAAGGCCGAATGGAGTT
CTCCAAGGCAGCTGTGTCTCGTGTGGTAGAGGCCTCAGACCGCCTACAGCGCCGGGTGGAGGAACTCTGT
CAGCGAGTGTACAGCCGAGGGGACAGTGAGCCCCTCAGTGAGGCGGCTCAGGCACACACCCGAGAGCTGG
GCCGTGAGAACCGGCGACTGCAGGACTTGGCCACTCAGCTGCAGGAGAAACACCACCGCATCTCATTGGA
GTACTCCGAGCTCCAGGATAAAGTGACATCGGCAGAGACCAAGGTGCTGGAGATGGAGACAACAGTGGAG
GACTTGCAGTGGGACATCGAGAAGCTGCGGAAGCGAGAGCAAAAGCTCAATAAGCACCTGGCAGAGGCCT
TAGAGCAGCTTAACTCTGGCTACTATGTATCTGGGAGCTCCTCAGGCTTCCAGGGGGGCCAGATCACACT
CAGCATGCAGAAGTTTGAGATGCTGAATGCAGAGTTAGAGGAAAACCAGGAACTGGCCAACAGCCGTATG
GCAGAGCTGGAGAAACTGCAGGCCGAACTTCAGGGGGCTGTGCGGACCAATGAGCGCCTCAAGGTGGCCC
TGCGGAGCCTTCCTGAGGAGGTAGTGCGGGAGACGGGGGAGTACCGCATGCTGCAGGCCCAATTCTCACT
GCTCTACAACGAGTCTCTGCAAGTGAAGACCCAGCTAGACGAGGCTCGGGGCCTGCTGCTGGCCACAAAG
AACTCCCACCTGCGACACATCGAGCACATGGAGAGCGACGAGCTGGGGCTGCAGAAGAAGCTACGCACAG
AGGTCATTCAGCTGGAGGACACGCTGGCCCAGGTACGCAAGGAGTATGAGATGCTGCGCATCGAGTTTGA
GCAGAATCTGGCGGCCAACGAGCAGGCGGGGCCCATCAACCGTGAGATGCGCCACCTGATTAGTAGTCTT
CAAAACCACAACCACCAGCTAAAAGGGGACGCCCAGCGATACAAGCGGAAGCTTCGAGAAGTACAAGCTG
AGATTGGCAAGCTCCGGGCCCAGGCCAGTGGCTCTGCCCACTCCACCCCCAACCTGGGCCACCCAGAGGA
TTCTGGCGTCAGTGCCCCAGCCCCAGGGAAAGAGGAGGGTGGGCCAGGCCCTGTCAGTACCCCCGACAAC
AGAAAGGAGATGGCTCCAGTGCCTGGCACCACCACTACTACCACTTCAGTGAAGAAGGAGGAGCTGGTCC
CCTCTGAAGAGGACTTCCAGGGTATAACCCCTGGGGCCCAGGGCCCTTCCTCCCGGGGCCGAGAACCTGA
GGCCAGGCCCAAGCGGGAGCTTCGGGAACGGGAAGGTCCCAGCCTAGGACCTCCACCTGTAGCCTCCGCT
CTCTCAAGGGCTGATCGGGAGAAGGCCAAGGTGGAAGAAACCAAGCGGAAGGAATCAGAACTCCTCAAGG
GTCTCCGAGCAGAGCTCAAGAAGGCCCAGGAGAGCCAGAAGGAGATGAAACTGCTGCTGGATATGTACAA
GTCAGCGCCCAAGGAGCAGCGGGATAAGGTGCAGCTCATGGCAGCGGAACGCAAGGCTAAGGCCGAGGTT
GATGAGCTGCGGAGCCGCATCCGGGAATTGGAGGAGAGGGATCGAAGGGAGAGCAAGAAGATCGCGGATG
AGGATGCCCTGCGGCGCATTCGGCAGGCAGAGGAGCAGATAGAACACCTGCAGCGCAAGCTGGGTGCCAC
CAAGCAGGAGGAGGAGGCTCTGCTCTCAGAGATGGATGTGACAGGTCAGGCTTTTGAGGACATGCAGGAA
CAGAACGGGCGGCTGCTACAGCAGTTGCGGGAAAAGGATGATGCCAACTTTAAGCTAATGTCAGAGCGGA
TCAAGGCCAACCAGATTCACAAGCTGCTGCGGGAGGAGAAGGATGAGTTGGGCGAGCAGGTCCTTGGCCT
CAAGTCCCAGGTGGATGCCCAGCTGCTGACTGTGCAGAAGCTGGAGGAGAAGGAGCGAGCCTTGCAGGGC
AGCCTCGGGGGTGTGGAGAAGGAGCTGACGCTGCGCAGCCAAGCCCTGGAGCTCAACAAGCGGAAGGCTG
TAGAAGCCGCCCAGCTGGCCGAGGACCTGAAGGTGCAGCTGGAGCACGTGCAGACTCGGCTGCGGGAGAT
CCAGCCCTGCCTGGCAGAGAGCCGGGCTGCTCGTGAGAAAGAGAGCTTCAACCTCAAGAGGGCTCAGGAG
GACATCTCACGGCTGCGGCGCAAGCTGGAAAAGCAGAGGAAGGTGGAGGTCTACGCAGATGCCGACGAAA
TCCTCCAGGAGGAGATCAAGGAGTACAAGGCGCGGTTGACCTGCCCCTGCTGTAACACCCGCAAGAAGGA
TGCAGTCCTTACCAAGTGCTTCCACGTTTTCTGCTTCGAGTGCGTGCGGGGCCGCTATGAGGCCCGCCAG
AGGAAGTGCCCCAAGTGCAACGCGGCCTTTGGTGCCCACGACTTCCATCGTATCTACATCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200575 representing NM_014771
Red=Cloning site Green=Tags(s)

MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLAERLEQRQACE
DELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPE
PGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASDRLQRRVEELC
QRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVE
DLQWDIEKLRKREQKLNKHLAEALEQLNSGYYVSGSSSGFQGGQITLSMQKFEMLNAELEENQELANSRM
AELEKLQAELQGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLATK
NSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPINREMRHLISSL
QNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSAHSTPNLGHPEDSGVSAPAPGKEEGGPGPVSTPDN
RKEMAPVPGTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPPPVASA
LSRADREKAKVEETKRKESELLKGLRAELKKAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEV
DELRSRIRELEERDRRESKKIADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQE
QNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQG
SLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAAREKESFNLKRAQE
DISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAVLTKCFHVFCFECVRGRYEARQ
RKCPKCNAAFGAHDFHRIYIS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014771
ORF Size 3003 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014771.3
RefSeq Size 4256 bp
RefSeq ORF 3006 bp
Locus ID 9810
UniProt ID O75150
Cytogenetics 16p11.2
Domains RING
Protein Families Druggable Genome
MW 113.5 kDa
Gene Summary The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.