NDUFB10 (NM_004548) Human Tagged ORF Clone

CAT#: RC200526

NDUFB10 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein

Product Images

Circular map for RC200526

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY NDUFB10 (Cat# RC200526, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-NDUFB10(Cat# TA505113). Positive lysates LY417917 (100ug) and LC417917 (20ug) can be purchased separately from OriGene.

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY NDUFB10 (RC200526, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-NDUFB10 (TA505207). Positive lysates LY417917 (100ug) and LC417917 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY417917) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200526 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Anti-NDUFB10 mouse monoclonal antibody (TA505207) immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY NDUFB10 (RC200526).

Show all 5 images

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NDUFB10
• Synonyms: PDSW
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200526 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCGGACAGCTGGGACAAGGATGTGTACCCTGAGCCCCCGCGCCGCACGCCGGTGCAGCCCAATCCCA
  TCGTCTACATGATGAAAGCGTTCGACCTCATCGTGGACCGACCCGTGACCCTCGTGAGAGAATTTATAGA
  GCGGCAGCACGCAAAGAACAGGTATTACTACTACCACCGGCAGTACCGCCGCGTGCCAGACATCACTGAG
  TGCAAGGAGGAGGACATCATGTGCATGTATGAAGCCGAAATGCAGTGGAAGAGGGACTACAAAGTCGACC
  AAGAAATTATCAACATTATGCAGGATCGGCTCAAAGCCTGTCAGCAGAGGGAAGGACAGAACTACCAGCA
  GAACTGTATCAAGGAAGTGGAGCAGTTCACCCAGGTGGCCAAGGCCTACCAGGACCGCTATCAGGACCTG
  GGGGCCTACAGTTCTGCCAGGAAGTGCCTGGCCAAACAGAGGCAGAGGATGCTGCAAGAGAGAAAAGCTG
  CAAAAGAGGCCGCCGCTGCCACCTCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200526 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITE
  CKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL
  GAYSSARKCLAKQRQRMLQERKAAKEAAAATS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_004548
• ORF Size: 516 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_004548.3
• RefSeq Size: 741 bp
• RefSeq ORF: 519 bp
• Locus ID: 4716
• UniProt ID: O96000
• Cytogenetics: 16p13.3
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
• MW: 20.8 kDa
• Gene Summary: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.[UniProtKB/Swiss-Prot Function]