DAB2 (NM_001343) Human Tagged ORF Clone

CAT#: RC200481

Reviews ()
Write a review

DAB2 (Myc-DDK-tagged)-Human disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila) (DAB2)



Reconstitution Protocol

USD 705.00

USD 1,057.00

In Stock*

Size
    • 10 ug

Product images

Other products for "DAB2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DAB2
Synonyms DOC-2; DOC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200481 representing NM_001343
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAACGAAGTAGAAACAAGTGCAACCAATGGTCAGCCCGACCAACAGGCCGCACCAAAAGCACCCT
CAAAGAAGGAAAAAAAGAAAGGCCCTGAAAAGACAGATGAATATCTCTTAGCAAGGTTCAAAGGCGATGG
TGTAAAATATAAGGCCAAGCTGATTGGCATTGATGATGTGCCAGATGCAAGAGGGGATAAAATGAGCCAA
GACTCTATGATGAAACTAAAGGGAATGGCGGCAGCTGGTCGGTCTCAGGGACAACACAAACAAAGGATCT
GGGTCAACATTTCCCTTTCTGGGATAAAAATAATTGATGAGAAAACTGGGGTAATAGAGCATGAACATCC
AGTAAATAAGATTTCTTTCATTGCCCGTGATGTGACAGACAACCGGGCATTTGGTTACGTGTGTGGAGGA
GAAGGCCAGCATCAGTTTTTTGCCATAAAAACCGGGCAACAGGCTGAACCATTAGTTGTTGATCTTAAAG
ACCTTTTTCAAGTTATCTATAATGTAAAGAAAAAGGAAGAAGAAAAGAAAAAGATAGAGGAAGCCAGCAA
AGCAGTTGAGAATGGGAGTGAGGCCCTAATGATTCTAGATGACCAAACTAACAAACTGAAATCGGGTGTT
GACCAGATGGATTTGTTTGGGGACATGTCTACACCTCCTGACCTAAATAGTCCAACAGAAAGCAAAGATA
TCCTGTTAGTGGATCTAAACTCTGAAATCGACACCAATCAGAATTCTTTAAGAGAAAATCCATTCTTAAC
AAACGGCATCACCTCCTGTTCTCTTCCTCGACCAACGCCTCAGGCATCCTTCTTGCCTGAAAATGCCTTT
TCTGCCAATCTCAACTTCTTTCCCACCCCTAATCCTGATCCTTTCCGTGACGATCCTTTCACACAGCCAG
ACCAATCGACACCTTCTTCGTTTGATTCTCTCAAATCTCCAGATCAGAAGAAAGAGAATTCGAGTAGCTC
GTCTACTCCGCTGAGTAATGGGCCCCTGAATGGTGATGTTGACTACTTTGGTCAGCAATTTGACCAGATC
TCTAACCGGACTGGCAAACAGGAAGCTCAGGCAGGCCCATGGCCCTTTTCAAGTTCGCAAACCCAGCCAG
CAGTGAGAACTCAAAATGGGGTATCTGAAAGAGAACAGAACGGCTTCTCTGTCAAATCCTCCCCGAACCC
TTTTGTGGGAAGCCCTCCCAAAGGACTGTCCATACAGAATGGCGTAAAGCAGGACTTGGAAAGCTCTGTC
CAGTCCTCACCACATGACTCCATAGCCATTATCCCACCTCCACAAAGTACCAAACCAGGAAGAGGCAGAA
GGACTGCTAAGTCTTCAGCCAATGACTTGCTTGCATCAGACATCTTTGCTCCTCCCGTCTCAGAACCTTC
AGGCCAGGCGTCACCCACAGGACAACCTACAGCCCTGCAGCCCAACCCTCTGGATCTCTTCAAAACAAGT
GCTCCTGCCCCAGTGGGGCCCCTGGTGGGTCTAGGTGGTGTAACTGTCACACTCCCTCAGGCAGGACCAT
GGAACACAGCATCTTTGGTCTTCAATCAGTCCCCTTCAATGGCTCCGGGAGCCATGATGGGTGGTCAACC
TTCAGGTTTTAGTCAGCCCGTCATTTTTGGTACAAGTCCAGCTGTTTCAGGTTGGAACCAGCCTTCACCC
TTTGCAGCCTCAACTCCCCCTCCAGTGCCTGTTGTCTGGGGCCCTTCTGCATCTGTGGCACCCAATGCTT
GGTCAACAACAAGCCCTTTGGGGAATCCTTTTCAGAGCAATATTTTTCCAGCTCCTGCTGTGTCCACTCA
GCCCCCATCCATGCACTCCTCTCTCCTGGTCACTCCTCCTCAGCCACCTCCCAGAGCTGGCCCTCCCAAG
GACATCTCCAGTGATGCCTTCACTGCCTTAGACCCACTTGGGGATAAAGAGATCAAGGATGTGAAAGAAA
TGTTTAAGGATTTCCAACTGCGGCAGCCACCTGTTGTGCCCGCGCGGAAGGGAGAGCAGACTTCTTCTGG
GACTTTGAGTGCCTTTGCCAGTTATTTCAACAGCAAGGTTGGCATTCCTCAGGAGAATGCAGACCATGAT
GACTTTGATGCTAATCAACTATTGAACAAGATCAATGAACCACCAAAGCCAGCTCCCAGACAAGTTTCCC
TGCCAGTTACCAAATCTACTGACAATGCATTTGAGAACCCTTTCTTTAAAGATTCTTTTGGTTCATCACA
AGCCTCTGTGGCTTCTTCTCAACCTGTATCTTCTGAGATGTATAGGGATCCATTTGGAAATCCTTTTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200481 representing NM_001343
Red=Cloning site Green=Tags(s)

MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQ
DSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGG
EGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGV
DQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAF
SANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQI
SNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTS
APAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSP
FAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPK
DISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPVVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHD
DFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001343
ORF Size 2310 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001343.4
RefSeq Size 3268 bp
RefSeq ORF 2313 bp
Locus ID 1601
UniProt ID P98082
Cytogenetics 5p13.1
Domains PID
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 82.3 kDa
Gene Summary This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains of GRB2, an adaptor protein that couples tyrosine kinase receptors to SOS (a guanine nucleotide exchange factor for Ras), via its C-terminal proline-rich sequences, and may thus modulate growth factor/Ras pathways by competing with SOS for binding to GRB2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.