DAB2 (NM_001343) Human Tagged ORF Clone

CAT#: RG200481

DAB2 (GFP-tagged) - Human disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila) (DAB2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DAB2 (NM_001343) Human Tagged ORF Clone
Symbol DAB2
Synonyms DOC-2; DOC2
Vector pCMV6-AC-GFP
Sequence Data
>RG200481 representing NM_001343
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAACGAAGTAGAAACAAGTGCAACCAATGGTCAGCCCGACCAACAGGCCGCACCAAAAGCACCCT
CAAAGAAGGAAAAAAAGAAAGGCCCTGAAAAGACAGATGAATATCTCTTAGCAAGGTTCAAAGGCGATGG
TGTAAAATATAAGGCCAAGCTGATTGGCATTGATGATGTGCCAGATGCAAGAGGGGATAAAATGAGCCAA
GACTCTATGATGAAACTAAAGGGAATGGCGGCAGCTGGTCGGTCTCAGGGACAACACAAACAAAGGATCT
GGGTCAACATTTCCCTTTCTGGGATAAAAATAATTGATGAGAAAACTGGGGTAATAGAGCATGAACATCC
AGTAAATAAGATTTCTTTCATTGCCCGTGATGTGACAGACAACCGGGCATTTGGTTACGTGTGTGGAGGA
GAAGGCCAGCATCAGTTTTTTGCCATAAAAACCGGGCAACAGGCTGAACCATTAGTTGTTGATCTTAAAG
ACCTTTTTCAAGTTATCTATAATGTAAAGAAAAAGGAAGAAGAAAAGAAAAAGATAGAGGAAGCCAGCAA
AGCAGTTGAGAATGGGAGTGAGGCCCTAATGATTCTAGATGACCAAACTAACAAACTGAAATCGGGTGTT
GACCAGATGGATTTGTTTGGGGACATGTCTACACCTCCTGACCTAAATAGTCCAACAGAAAGCAAAGATA
TCCTGTTAGTGGATCTAAACTCTGAAATCGACACCAATCAGAATTCTTTAAGAGAAAATCCATTCTTAAC
AAACGGCATCACCTCCTGTTCTCTTCCTCGACCAACGCCTCAGGCATCCTTCTTGCCTGAAAATGCCTTT
TCTGCCAATCTCAACTTCTTTCCCACCCCTAATCCTGATCCTTTCCGTGACGATCCTTTCACACAGCCAG
ACCAATCGACACCTTCTTCGTTTGATTCTCTCAAATCTCCAGATCAGAAGAAAGAGAATTCGAGTAGCTC
GTCTACTCCGCTGAGTAATGGGCCCCTGAATGGTGATGTTGACTACTTTGGTCAGCAATTTGACCAGATC
TCTAACCGGACTGGCAAACAGGAAGCTCAGGCAGGCCCATGGCCCTTTTCAAGTTCGCAAACCCAGCCAG
CAGTGAGAACTCAAAATGGGGTATCTGAAAGAGAACAGAACGGCTTCTCTGTCAAATCCTCCCCGAACCC
TTTTGTGGGAAGCCCTCCCAAAGGACTGTCCATACAGAATGGCGTAAAGCAGGACTTGGAAAGCTCTGTC
CAGTCCTCACCACATGACTCCATAGCCATTATCCCACCTCCACAAAGTACCAAACCAGGAAGAGGCAGAA
GGACTGCTAAGTCTTCAGCCAATGACTTGCTTGCATCAGACATCTTTGCTCCTCCCGTCTCAGAACCTTC
AGGCCAGGCGTCACCCACAGGACAACCTACAGCCCTGCAGCCCAACCCTCTGGATCTCTTCAAAACAAGT
GCTCCTGCCCCAGTGGGGCCCCTGGTGGGTCTAGGTGGTGTAACTGTCACACTCCCTCAGGCAGGACCAT
GGAACACAGCATCTTTGGTCTTCAATCAGTCCCCTTCAATGGCTCCGGGAGCCATGATGGGTGGTCAACC
TTCAGGTTTTAGTCAGCCCGTCATTTTTGGTACAAGTCCAGCTGTTTCAGGTTGGAACCAGCCTTCACCC
TTTGCAGCCTCAACTCCCCCTCCAGTGCCTGTTGTCTGGGGCCCTTCTGCATCTGTGGCACCCAATGCTT
GGTCAACAACAAGCCCTTTGGGGAATCCTTTTCAGAGCAATATTTTTCCAGCTCCTGCTGTGTCCACTCA
GCCCCCATCCATGCACTCCTCTCTCCTGGTCACTCCTCCTCAGCCACCTCCCAGAGCTGGCCCTCCCAAG
GACATCTCCAGTGATGCCTTCACTGCCTTAGACCCACTTGGGGATAAAGAGATCAAGGATGTGAAAGAAA
TGTTTAAGGATTTCCAACTGCGGCAGCCACCTGCTGTGCCCGCGCGGAAGGGAGAGCAGACTTCTTCTGG
GACTTTGAGTGCCTTTGCCAGTTATTTCAACAGCAAGGTTGGCATTCCTCAGGAGAATGCAGACCATGAT
GACTTTGATGCTAATCAACTATTGAACAAGATCAATGAACCACCAAAGCCAGCTCCCAGACAAGTTTCCC
TGCCAGTTACCAAATCTACTGACAATGCATTTGAGAACCCTTTCTTTAAAGATTCTTTTGGTTCATCACA
AGCCTCTGTGGCTTCTTCTCAACCTGTATCTTCTGAGATGTATAGGGATCCATTTGGAAATCCTTTTGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200481 representing NM_001343
Red=Cloning site Green=Tags(s)

MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQ
DSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGG
EGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGV
DQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAF
SANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQI
SNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTS
APAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSP
FAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPK
DISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHD
DFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001343
ORF Size 2310 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001343.1, NP_001334
RefSeq Size 3268
RefSeq ORF 2313
Locus ID 1601
Cytogenetics 5p13.1
Domains PID
Protein Families Druggable Genome
Protein Pathways Endocytosis
Gene Summary This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains of GRB2, an adaptor protein that couples tyrosine kinase receptors to SOS (a guanine nucleotide exchange factor for Ras), via its C-terminal proline-rich sequences, and may thus modulate growth factor/Ras pathways by competing with SOS for binding to GRB2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)