Hydroxysteroid (17 beta) Dehydrogenase 4 (HSD17B4) (NM_000414) Human Tagged ORF Clone

CAT#: RC200460

Reviews ()
Write a review

HSD17B4 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 4 (HSD17B4), transcript variant 2



  "NM_000414" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HSD17B4
Synonyms DBP; MFE-2; MFP-2; MPF-2; PRLTS1; SDR8C1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200460 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCACCGCTGAGGTTCGACGGGCGGGTGGTACTGGTCACCGGCGCGGGGGCAGGATTGGGCCGAG
CCTATGCCCTGGCTTTTGCAGAAAGAGGAGCGTTAGTTGTTGTGAATGATTTGGGAGGGGACTTCAAAGG
AGTTGGTAAAGGCTCCTTAGCTGCTGATAAGGTTGTTGAAGAAATAAGAAGGAGAGGTGGAAAAGCAGTG
GCCAACTATGATTCAGTGGAAGAAGGAGAGAAGGTTGTGAAGACAGCCCTGGATGCTTTTGGAAGAATAG
ATGTTGTGGTCAACAATGCTGGAATTCTGAGGGATCGTTCCTTTGCTAGGATAAGTGATGAAGACTGGGA
TATAATCCACAGAGTTCATTTGCGGGGTTCATTCCAAGTGACACGGGCAGCATGGGAACACATGAAGAAA
CAGAAGTATGGAAGGATTATTATGACTTCATCAGCTTCAGGAATATATGGCAACTTTGGCCAGGCCAATT
ATAGTGCTGCAAAGTTGGGTCTTCTGGGCCTTGCAAATTCTCTTGCAATTGAAGGCAGGAAAAGCAACAT
TCATTGTAACACCATTGCTCCTAATGCGGGATCACGGATGACTCAGACAGTTATGCCTGAAGATCTTGTG
GAAGCCCTGAAGCCAGAGTATGTGGCACCTCTTGTCCTTTGGCTTTGTCACGAGAGTTGTGAGGAGAATG
GTGGCTTGTTTGAGGTTGGAGCAGGATGGATTGGAAAATTACGCTGGGAGCGGACTCTTGGAGCTATTGT
AAGACAAAAGAATCACCCAATGACTCCTGAGGCAGTCAAGGCTAACTGGAAGAAGATCTGTGACTTTGAG
AATGCCAGCAAGCCTCAGAGTATCCAAGAATCAACTGGCAGTATAATTGAAGTTCTGAGTAAAATAGATT
CAGAAGGAGGAGTTTCAGCAAATCATACTAGTCGTGCAACGTCTACAGCAACATCAGGATTTGCTGGAGC
TATTGGCCAGAAACTCCCTCCATTTTCTTATGCTTATACGGAACTGGAAGCTATTATGTATGCCCTTGGA
GTGGGAGCGTCAATCAAGGATCCAAAAGATTTGAAATTTATTTATGAAGGAAGTTCTGATTTCTCCTGTT
TGCCCACCTTCGGAGTTATCATAGGTCAGAAATCTATGATGGGTGGAGGATTAGCAGAAATTCCTGGACT
TTCAATCAACTTTGCAAAGGTTCTTCATGGAGAGCAGTACTTAGAGTTATATAAACCACTTCCCAGAGCA
GGAAAATTAAAATGTGAAGCAGTTGTTGCTGATGTCCTAGATAAAGGATCCGGTGTAGTGATTATTATGG
ATGTCTATTCTTATTCTGAGAAGGAACTTATATGCCACAATCAGTTCTCTCTCTTTCTTGTTGGCTCTGG
AGGCTTTGGTGGAAAACGGACATCAGACAAAGTCAAGGTAGCTGTAGCCATACCTAATAGACCTCCTGAT
GCTGTACTTACAGATACCACCTCTCTTAATCAGGCTGCTTTGTACCGCCTCAGTGGAGACTGGAATCCCT
TACACATTGATCCTAACTTTGCTAGTCTAGCAGGTTTTGACAAGCCCATATTACATGGATTATGTACATT
TGGATTTTCTGCCAGGCGTGTGTTACAGCAGTTTGCAGATAATGATGTGTCAAGATTCAAGGCAATTAAG
GCTCGTTTTGCAAAACCAGTATATCCAGGACAAACTCTACAAACTGAGATGTGGAAGGAAGGAAACAGAA
TTCATTTTCAAACCAAGGTCCAAGAAACTGGAGACATTGTCATTTCAAATGCATATGTGGATCTTGCACC
AACATCTGGTACTTCAGCTAAGACACCCTCTGAGGGCGGGAAGCTTCAGAGTACCTTTGTATTTGAGGAA
ATAGGACGCCGCCTAAAGGATATTGGGCCTGAGGTGGTGAAGAAAGTAAATGCTGTATTTGAGTGGCATA
TAACCAAAGGCGGAAATATTGGGGCTAAGTGGACTATTGACCTGAAAAGTGGTTCTGGAAAAGTGTACCA
AGGCCCTGCAAAAGGTGCTGCTGATACAACAATCATACTTTCAGATGAAGATTTCATGGAGGTGGTCCTG
GGCAAGCTTGACCCTCAGAAGGCATTCTTTAGTGGCAGGCTGAAGGCCAGAGGGAACATCATGCTGAGCC
AGAAACTTCAGATGATTCTTAAAGACTACGCCAAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200460 protein sequence
Red=Cloning site Green=Tags(s)

MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAV
ANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKK
QKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLV
EALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFE
NASKPQSIQESTGSIIEVLSKIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALG
VGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRA
GKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPD
AVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIK
ARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEE
IGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVL
GKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000414
ORF Size 2208 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000414.4
RefSeq Size 2710 bp
RefSeq ORF 2211 bp
Locus ID 3295
UniProt ID P51659
Cytogenetics 5q23.1
Domains adh_short, MaoC_dehydratas, SCP2
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Primary bile acid biosynthesis
MW 79.7 kDa
Gene Summary The protein encoded by this gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathway for fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids. Defects in this gene that affect the peroxisomal fatty acid beta-oxidation activity are a cause of D-bifunctional protein deficiency (DBPD). An apparent pseudogene of this gene is present on chromosome 8. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]

Other Versions

Other products for "HSD17B4"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


HSD17B4 mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.