SAM68 (KHDRBS1) (NM_006559) Human Tagged ORF Clone

CAT#: RC200263

Reviews ()
Write a review

KHDRBS1 (Myc-DDK-tagged)-Human KH domain containing, RNA binding, signal transduction associated 1 (KHDRBS1)



Reconstitution Protocol

USD 457.00

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "KHDRBS1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KHDRBS1
Synonyms p62; p68; Sam68
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200263 representing NM_006559
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCGCCGGGACGACCCCGCCGCGCGCATGAGCCGGTCTTCGGGCCGTAGCGGCTCCATGGACCCCT
CCGGTGCCCACCCCTCGGTGCGTCAGACGCCGTCTCGGCAGCCGCCGCTGCCTCACCGGTCCCGGGGAGG
CGGAGGGGGATCCCGCGGGGGCGCCCGGGCCTCGCCCGCCACGCAGCCGCCACCGCTGCTGCCGCCCTCG
GCCACGGGTCCCGACGCGACAGTGGGCGGGCCAGCGCCGACCCCGCTGCTGCCCCCCTCGGCCACAGCCT
CGGTCAAGATGGAGCCAGAGAACAAGTACCTGCCCGAACTCATGGCCGAGAAGGACTCGCTCGACCCGTC
CTTCACTCACGCCATGCAGCTGCTGACGGCAGAAATTGAGAAGATTCAGAAAGGAGACTCAAAAAAGGAT
GATGAGGAGAATTACTTGGATTTATTTTCTCATAAGAACATGAAACTGAAAGAGCGAGTGCTGATACCTG
TCAAGCAGTATCCCAAGTTCAATTTTGTGGGGAAGATTCTTGGACCACAAGGGAATACAATCAAAAGACT
GCAGGAAGAGACTGGTGCAAAGATCTCTGTATTGGGAAAGGGCTCAATGAGAGACAAAGCCAAGGAGGAA
GAGCTGCGCAAAGGTGGAGACCCCAAATATGCCCACTTGAATATGGATCTGCATGTCTTCATTGAAGTCT
TTGGACCCCCATGTGAGGCTTATGCTCTTATGGCCCATGCCATGGAGGAAGTCAAGAAATTTCTAGTACC
GGATATGATGGATGATATCTGTCAGGAGCAATTTCTAGAGCTGTCCTACTTGAATGGAGTACCTGAACCC
TCTCGTGGACGTGGGGTGCCAGTGAGAGGCCGGGGAGCTGCACCTCCTCCACCACCTGTTCCCAGGGGCC
GTGGTGTTGGACCACCTCGGGGGGCTTTGGTACGTGGTACACCAGTAAGGGGAGCCATCACCAGAGGTGC
CACTGTGACTCGAGGCGTGCCACCCCCACCTACTGTGAGGGGTGCTCCAGCACCAAGAGCACGGACAGCG
GGCATCCAGAGGATACCTTTGCCTCCACCTCCTGCACCAGAAACATATGAAGAATATGGATATGATGATA
CATACGCAGAACAAAGTTACGAAGGCTACGAAGGCTATTACAGCCAGAGTCAAGGGGACTCAGAATATTA
TGACTATGGACATGGGGAGGTTCAAGATTCTTATGAAGCTTATGGCCAGGACGACTGGAATGGGACCAGG
CCGTCGCTGAAGGCCCCTCCTGCTAGGCCAGTGAAGGGAGCATACAGAGAGCACCCATATGGACGTTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200263 representing NM_006559
Red=Cloning site Green=Tags(s)

MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPS
ATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKD
DEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEE
ELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEP
SRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTA
GIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006559
ORF Size 1329 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006559.3
RefSeq Size 2685 bp
RefSeq ORF 1332 bp
Locus ID 10657
UniProt ID Q07666
Cytogenetics 1p35.2
Domains KH
Protein Families Transcription Factors
MW 48 kDa
Gene Summary This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.