NSG2(HMP19) (NM_015980) Human Tagged ORF Clone

CAT#: RC200019

HMP19 (Myc-DDK-tagged)-Human HMP19 protein (HMP19)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name NSG2(HMP19) (NM_015980) Human Tagged ORF Clone
Symbol HMP19
Synonyms NSG2; hypothalamus golgi apparatus expressed 19 kDa protein; p19 protein; HMP19 protein
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200019 representing NM_015980
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGAAGCTGAACAGTAACCCCAGCGAGAAGGGAACCAAGCCGCCTTCAGTTGAGGATGGCTTCCAGA
CCGTCCCTCTCATCACTCCCTTGGAGGTTAATCACTTACAGCTGCCTGCTCCAGAAAAGGTGATTGTGAA
GACAAGAACGGAATATCAGCCGGAACAGAAGAACAAAGGGAAGTTCCGGGTGCCGAAAATCGCTGAATTT
ACGGTCACCATCCTTGTCAGCCTGGCCCTAGCTTTCCTTGCGTGCATCGTGTTCCTGGTGGTTTACAAAG
CCTTCACCTATGATCACAGCTGCCCAGAGGGATTCGTCTATAAGCACAAACGCTGTATCCCAGCCTCCCT
GGATGCTTACTACTCCTCCCAGGACCCCAATTCCAGAAGCCGCTTCTACACAGTCATCAGCCACTACAGC
GTGGCCAAGCAGAGCACTGCCCGGGCCATCGGGCCGTGGCTGTCAGCAGCCGCTGTCATCCATGAGCCCA
AGCCGCCCAAGACCCAGGGCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200019 representing NM_015980
Red=Cloning site Green=Tags(s)

MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEF
TVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYS
VAKQSTARAIGPWLSAAAVIHEPKPPKTQGH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015980
ORF Size 513 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015980.1, NM_015980.2, NM_015980.3, NM_015980.4, NP_057064
RefSeq Size 2356
RefSeq ORF 516
Locus ID 51617
Cytogenetics 5q35.2
Protein Families Transmembrane, Druggable Genome
MW 18.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.