Kcnab1 (NM_001289450) Mouse Tagged ORF Clone

CAT#: MR229076

  • TrueORF®

Kcnab1 (myc-DDK-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, beta member 1 (Kcnab1), transcript variant 2


  "NM_001289450" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 330.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Kcnab1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Kcnab1
Synonyms Akr8a8; Kvbeta1.1; mKv(beta)1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229076 representing NM_001289450
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAATTGCCTACGAAAGTGGAGTTAATCTCTTCGACACAGCTGAGGTCTATGCTGCTGGGAAGGCTG
AGGTGATTCTGGGAAGCATCATCAAGAAGAAAGGCTGGAGGAGGTCCAGCTTGGTCATCACAACCAAACT
CTACTGGGGTGGAAAAGCTGAGACAGAAAGGGGACTGTCAAGAAAGCACATCATTGAAGGACTGAAAGGC
TCCCTCCAGAGGCTGCAACTGGAATACGTGGATGTGGTCTTTGCAAATCGCCCAGACAGCAACACTCCCA
TGGAAGAAATCGTTCGAGCCATGACGCACGTGATCAACCAAGGCATGGCCATGTACTGGGGCACCTCGAG
GTGGAGCGCGATGGAGATCATGGAAGCCTACTCTGTCGCACGGCAGTTCAACATGATCCCGCCTGTCTGT
GAGCAAGCTGAGTACCATCTTTTCCAGAGAGAGAAGGTGGAGGTCCAGCTGCCGGAGCTCTACCATAAAA
TAGGAGTTGGTGCAATGACATGGTCTCCACTTGCTTGTGGAATTATTTCAGGAAAATATGGAAATGGGGT
GCCAGAAAGTTCTAGAGCTTCACTGAAGTGCTACCAGTGGTTGAAGGAAAGAATCGTAAGTGAAGAAGGG
AGAAAACAGCAAAACAAGCTGAAAGACCTCTCTCCAATCGCTGAGCGCCTGGGGTGCACGCTACCTCAGC
TGGCTGTGGCGTGGTGCCTGAGAAATGAGGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCGGAACA
ACTCATTGAAAACCTTGGTGCCATTCAGGTCCTCCCTAAGATGACATCTCACGTGGTGAACGAGATTGAT
AACATACTGCGCAACAAGCCCTACAGCAAAAAGGACTATAGATCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229076 representing NM_001289450
Red=Cloning site Green=Tags(s)

MTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKG
SLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVC
EQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEG
RKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEID
NILRNKPYSKKDYRS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001289450
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001289450.1, NP_001276379.1
RefSeq Size 2851 bp
RefSeq ORF 888 bp
Locus ID 16497
Cytogenetics 3 30.15 cM
MW 33.6 kDa
Gene Summary Cytoplasmic potassium channel subunit that modulates the characteristics of the channel-forming alpha-subunits (PubMed:10454353). Modulates action potentials via its effect on the pore-forming alpha subunits (PubMed:10454353). Promotes expression of the pore-forming alpha subunits at the cell membrane, and thereby increases channel activity (PubMed:8824288). Mediates closure of delayed rectifier potassium channels by physically obstructing the pore via its N-terminal domain and increases the speed of channel closure for other family members (By similarity). Promotes the closure of KCNA1, KCNA2 and KCNA5 channels (By similarity). Accelerates KCNA4 channel closure (By similarity). Accelerates the closure of heteromeric channels formed by KCNA1 and KCNA4 (By similarity). Accelerates the closure of heteromeric channels formed by KCNA2, KCNA5 and KCNA6 (By similarity). Enhances KCNB1 and KCNB2 channel activity (PubMed:8824288). Binds NADPH; this is required for efficient down-regulation of potassium channel activity (By similarity). Has NADPH-dependent aldoketoreductase activity (By similarity). Oxidation of the bound NADPH strongly decreases N-type inactivation of potassium channel activity (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.