Gdf11 (NM_010272) Mouse Tagged ORF Clone

CAT#: MR223819

Gdf11 (Myc-DDK-tagged) - Mouse growth differentiation factor 11 (Gdf11)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gdf11 (NM_010272) Mouse Tagged ORF Clone
Symbol Gdf11
Synonyms BMP-11; Bmp11
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR223819 representing NM_010272
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGCTCGCGGCCCCGCTGCTGCTGGGCTTCCTGCTCCTCGCCCTGGAGCTGCGGCCCCGGGGGGAGG
CGGCCGAGGGCCCCGCGGCGGCGGCGGCGGCAGCGGCGGCGGCGGCCGGGGTCGGGGGGGAGCGCTCGAG
CCGGCCGGCCCCGTCCGCTCCGCCGGAGCCGGACGGCTGCCCCGTGTGCGTGTGGCGGCAGCACAGCCGC
GAGCTGCGCCTAGAGAGCATCAAGTCGCAGATCCTGAGCAAACTGCGGCTCAAGGAGGCGCCCAACATCA
GCCGGGAGGTAGTGAAGCAGCTGCTGCCCAAGGCGCCGCCGCTGCAGCAGATCCTGGATCTGCACGACTT
CCAAGGCGACGCGCTGCAGCCTGAGGACTTCTTGGAAGAGGACGAGTACCACGCTACCACCGAGACGGTC
ATAAGCATGGCCCAGGAGACGGACCCTGCAGTGCAGACAGATGGCAGCCCTCTCTGCTGTCATTTCCACT
TCAGCCCCAAGGTGATGTTCACCAAGGTACTGAAGGCCCAACTGTGGGTGTACCTTCGGCCTGTGCCCCG
CCCAGCCACAGTCTACCTGCAGATCTTACGACTGAAACCCCTAACTGGGGAAGGGACCGCAGGGGGAGGG
GGTGGAGGCCGGCGTCACATCCGTATCCGTTCACTAAAGATTGAGCTACACTCACGTTCCGGCCACTGGC
AGAGCATCGACTTCAAGCAAGTGCTACACAGCTGGTTTCGCCAGCCACAGAGCAACTGGGGAATCGAGAT
CAACGCCTTTGATCCCAGCGGCACAGACCTGGCTGTCACCTCCCTGGGGCCAGGAGCTGAGGGGCTGCAT
CCTTTCATGGAGCTTCGAGTCCTAGAGAACACGAAAAGGTCCCGGCGGAACCTAGGCCTGGACTGCGATG
AACACTCGAGTGAGTCCCGCTGCTGCCGATATCCTCTCACAGTGGACTTTGAGGCTTTTGGCTGGGACTG
GATCATCGCACCTAAGCGCTACAAGGCCAACTACTGCTCCGGCCAGTGCGAATACATGTTCATGCAAAAG
TATCCACACACCCACTTGGTGCAACAGGCCAACCCAAGAGGCTCTGCTGGGCCCTGCTGCACCCCTACCA
AGATGTCCCCAATCAACATGCTCTACTTCAATGACAAGCAGCAGATTATCTACGGCAAGATCCCTGGCAT
GGTGGTGGATCGATGTGGCTGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR223819 representing NM_010272
Red=Cloning site Green=Tags(s)

MVLAAPLLLGFLLLALELRPRGEAAEGPAAAAAAAAAAAGVGGERSSRPAPSAPPEPDGCPVCVWRQHSR
ELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQGDALQPEDFLEEDEYHATTETV
ISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWVYLRPVPRPATVYLQILRLKPLTGEGTAGGG
GGGRRHIRIRSLKIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLH
PFMELRVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQK
YPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010272
ORF Size 1215 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010272.1, NM_010272.2, NP_034402
RefSeq Size 1811
RefSeq ORF 1218
Locus ID 14561
Cytogenetics 10|10 D3
MW 45.4 kDa
Gene Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging. Mice lacking a functional copy of this gene exhibit impaired anteroposterior patterning and other developmental defects. [provided by RefSeq, Aug 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)