Adam23 (NM_001177600) Mouse Tagged ORF Clone

CAT#: MR223654

Reviews ()
Write a review
  • TrueORF®

Adam23 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 23 (Adam23), transcript variant 1



  "NM_001177600" in other vectors (4)

Interest in protein/lysate? Submit request here!

USD 500.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Adam23 (NM_001177600) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Adam23
Synonyms AW046396; MDC3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR223654 representing NM_001177600
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCGCCCGGCAGCATCTCCCGGCGGCCGACCCTGACGGGTTGCAGCCTTCCCGGCGCCTCCTGCG
GCCCCGGCCGCTGCCCCGCCGGCCCGGTGCCGGCCCGCGCGCCGCCCTGCCGCCTGCTCCTCGTCCTTCT
CCTGCTACCTGCGCTCGCCACCTCATCCCGGCCCCGTGCCCGGGGGGCCGCTGCGCCCAGCGCTCCGCAC
TGGAATGAAACTGCAGAAAAAACCCTGGGAGTCCTGGCAGATGAAGACAACACATTGCAACAAAATAGCA
GCAGCAGAAATACCAGCTACAGCAGTGCAGTGCAAAAAGAAATCACACTGCCTTCAAGACTGGTGTATTA
CATCAACCAGGACTCAGAAAGCCCCTATCATGTTCTTGACACAAAGGCCAGACACCAACAGAAACACAAT
AAGGCTGTGCATCTGGCCCAGGCAAGCTTCCAGATCGAAGCTTTCGGCTCCAAGTTCATTCTTGACCTCA
CACTGAACAATGGTTTGCTATCTTCTGACTACGTGGAGATCCACTATGAAGACGGGAAGCAGATGTACTC
TAAGGGTGGAGAGCACTGTTACTACCACGGAAGCATCAGAGGCGTCAAGGATTCCAGGGTGGCTCTATCG
ACCTGCAATGGACTCCATGGCATGTTTGAGGATGACACCTTTGTGTATATGATAGAGCCGCTGGAACTGA
CTGATGATGAGAAAAGCACAGGCCGACCACACATAATCCAGAAAACCTTGGCAGGACAGTATTCTAAGCA
GATGAAGAATCTCAGCACAGATGGCAGTGACCAGTGGCCTTTGCTACCTGAATTACAATGGCTGAGAAGA
AGGAAAAGAGCGGTCAATCCATCTCGTGGTGTGTTTGAAGAAATGAAGTATTTGGAGCTTATGATTGTTA
ATGATCACAAGACGTATAAGAAGCACCGCTCTTCTCACGCGCATACCAACAACTTCGCAAAGTCTGTGGT
CAACCTTGTAGATTCTATTTACAAGGAACAGCTCAACACCAGGGTTGTCCTGGTGGCTGTCGAGACCTGG
ACCGAGAAGGATCACATTGACATCACCATCAACCCCGTGCAGATGCTACATGACTTCTCCAAGTACCGGC
AGCGAATCAAACAGCACGCTGACGCGGTCCACCTCATCTCGCGCGTGACATTCCATTATAAGAGAAGCAG
TCTGAGTTACTTTGGAGGCGTGTGTTCTCGAATAAGAGGGGTTGGTGTGAATGAGTATGGTCTTCCAATG
GCGGTGGCACAAGTATTATCACAGAGCCTGGCTCAAAACCTTGGAATCCAGTGGGAACCTTCGAGCAGGA
AGCCAAAATGTGAATGCATAGAGTCCTGGGGCGGCTGCATCATGGAAGAAACAGGGGTGTCCCACTCTCG
AAAGTTCTCAAAGTGCAGCATTTTGGAGTACAGAGACTTTTTACAGAGAGGTGGCGGAGCATGTCTTTTC
AATAGGCCAACTAAGCTGTTTGAGCCCACGGAATGTGGAAATGGATATGTGGAGGCCGGGGAGGAATGCG
ACTGTGGTTTCCATGTGGAATGCTATGGAGTTTGCTGTAAGAAGTGTTCGCTCTCCAATGGGGCCCACTG
CAGTGACGGCCCCTGCTGTAACAACACCTCATGTCTTTTTCAGTCACGAGGGTATGAATGTCGGGATGCC
GTAAACAGCTGTGATATCACCGAGTACTGCACTGGAGACTCTGGCCAGTGCCCACCGAACCTCCATAAAC
AAGATGGCTATAGCTGCAATCAAAATCAGGGTCGCTGCTACAATGGCGAGTGCAAGACAAGGGACAATCA
ATGCCAGTACATCTGGGGGACAAAGGCTGCGGGGTCAGACAAGTTCTGCTATGAAAAGCTGAACACGGAA
GGCACCGAGAAGGGCAATTGTGGAAAGGATGGAGACCGGTGGATCCCGTGCAGCAAGCATGATGTGTTCT
GTGGATTTCTGCTTTGCACCAATCTTACCCGAGCTCCACGTATCGGTCAACTTCAAGGAGAGATCATCCC
GACTTCCTTCTATCATCAAGGCCGAGTGATTGACTGCAGTGGTGCTCATGTAGTTTTAGACGATGATACA
GACGTGGGTTACGTTGAAGATGGGACTCCGTGTGGCCCCTCCATGATGTGCTTAGATCGGAAGTGCCTAC
AGATTCAAGCCCTGAATATGAGCAGCTGCCCACTTGACTCAAGGGGTAAAGTCTGCTCCGGCCACGGGGT
GTGTAGCAACGAAGCCACCTGCATCTGTGATTTCACTTGGGCAGGCACAGACTGCAGCATCCGGGATCCA
GTTCGGAACCCCAACCCCCCTAAGGATGAAGGCCCTAAGGGTTTGTATGATTCCGGTTTTAGATCACTGC
AGATTATTCATCTCCCCTCTCCCACTGCAGCAGTAATCCACTTCCACAGCTTCAGAAGGAGGCACACAGG
AATATATCCTTTTGCCACAGAGATGCGCCATCCTGTGTGTACCACACTTTCAGAAGCATAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223654 representing NM_001177600
Red=Cloning site Green=Tags(s)

MKPPGSISRRPTLTGCSLPGASCGPGRCPAGPVPARAPPCRLLLVLLLLPALATSSRPRARGAAAPSAPH
WNETAEKTLGVLADEDNTLQQNSSSRNTSYSSAVQKEITLPSRLVYYINQDSESPYHVLDTKARHQQKHN
KAVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEIHYEDGKQMYSKGGEHCYYHGSIRGVKDSRVALS
TCNGLHGMFEDDTFVYMIEPLELTDDEKSTGRPHIIQKTLAGQYSKQMKNLSTDGSDQWPLLPELQWLRR
RKRAVNPSRGVFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETW
TEKDHIDITINPVQMLHDFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRIRGVGVNEYGLPM
AVAQVLSQSLAQNLGIQWEPSSRKPKCECIESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLF
NRPTKLFEPTECGNGYVEAGEECDCGFHVECYGVCCKKCSLSNGAHCSDGPCCNNTSCLFQSRGYECRDA
VNSCDITEYCTGDSGQCPPNLHKQDGYSCNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTE
GTEKGNCGKDGDRWIPCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDT
DVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSRGKVCSGHGVCSNEATCICDFTWAGTDCSIRDP
VRNPNPPKDEGPKGLYDSGFRSLQIIHLPSPTAAVIHFHSFRRRHTGIYPFATEMRHPVCTTLSEAY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001177600
ORF Size 2511 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001177600.1, NP_001171071.1
RefSeq Size 2880 bp
RefSeq ORF 2514 bp
Locus ID 23792
Cytogenetics 1 32.31 cM
MW 93.5 kDa
Gene Summary This gene encodes a member of the disintegrin family of membrane-anchored proteins that play a role in diverse biological processes such as brain development, fertilization, tumor development and inflammation. The encoded protein undergoes proteolytic processing to generate a mature polypeptide comprised of an inactive metalloprotease and disintegrin domains. Transgenic disruption of this gene in mice results in postnatal neurological defects including tremor and ataxia resulting in death by 2 weeks of age. [provided by RefSeq, Sep 2015]

Citations (1)

Other Versions

Other products for "Adam23"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-Adam23 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools