Arntl (NM_007489) Mouse Tagged ORF Clone

CAT#: MR209553

Arntl (Myc-DDK-tagged) - Mouse aryl hydrocarbon receptor nuclear translocator-like (Arntl)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 479.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Arntl (NM_007489) Mouse Tagged ORF Clone
Symbol Arntl
Synonyms Arnt3; bHLHe5; Bmal1; BMAL1b; bmal1b'; MOP3
Vector pCMV6-Entry
Sequence Data
>MR209553 representing NM_007489
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACCAGAGAATGGACATTTCCTCAACCATCAGCGACTTCATGTCTCCGGGCCCCACCGACCTAC
TCTCCGGTTCCCTGGGCACCAGTGGTGTGGACTGCAATCGCAAGAGGAAAGGCAGTGCCACTGACTACCA
AGAAAGTATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATGCAGAACACCAAGGAAGGATC
AAGAATGCAAGGGAGGCCCACAGTCAGATTGAAAAGAGGCGTCGGGACAAAATGAACAGTTTCATTGATG
AATTGGCTTCTTTGGTACCAACATGCAATGCAATGTCCAGGAAGTTAGATAAACTCACCGTGCTAAGGAT
GGCTGTTCAGCACATGAAAACTTTGAGAGGTGCCACCAACCCATACACAGAAGCAAACTACAAGCCAACA
TTTCTATCAGATGACGAACTGAAACACCTAATTCTCAGGGCAGCAGATGGATTTTTGTTTGTCGTAGGAT
GTGACCGAGGGAAGATCCTCTTTGTCTCCGAGTCTGTCTTCAAGATCCTCAATTATAGCCAGAATGACCT
TATTGGCCAGAGCTTGTTTGACTACCTGCATCCAAAAGATATTGCCAAAGTTAAGGAACAGCTATCTTCC
TCGGACACTGCGCCCCGGGAGCGACTCATTGATGCCAAGACTGGACTTCCGGTTAAAACGGATATAACCC
CTGGGCCCTCCCGGCTATGCTCTGGAGCCCGCCGCTCTTTCTTCTGTAGAATGAAGTGCAACAGGCCTTC
AGTAAAGGTGGAAGATAAGGACTTCGCCTCTACCTGTTCAAAGAAAAAAGCAGATCGAAAAAGCTTCTGC
ACAATCCACAGCACAGGCTATTTGAAAAGCTGGCCACCCACGAAGATGGGGCTGGACGAAGACAATGAGC
CAGACAACGAGGGCTGCAACCTCAGCTGCCTCGTTGCAATCGGGCGCCTGCACTCGCACATGGTTCCACA
ACCAGCGAACGGGGAAATACGGGTGAAATCTATGGAGTACGTTTCTCGACACGCAATAGATGGGAAATTT
GTTTTTGTAGATCAGAGGGCGACAGCTATTTTGGCGTATCTACCACAGGAACTTCTAGGTACATCATGTT
ATGAGTATTTTCATCAAGACGACATAGGACACCTCGCAGAATGTCACAGGCAAGTTTTACAGACAAGAGA
AAAGATCACAACTAATTGCTATAAGTTTAAGATCAAAGATGGTTCTTTTATCACGCTACGAAGTCGATGG
TTCAGTTTCATGAACCCGTGGACCAAGGAAGTTGAATACATTGTCTCAACCAACACTGTTGTTTTAGCCA
ATGTCCTGGAAGGCGGGGACCCAACCTTCCCGCAGCTAACAGCACCCCCCCACAGCATGGACAGCATGCT
GCCCTCTGGAGAAGGTGGCCCAAAGAGGACTCATCCCACTGTCCCAGGCATTCCAGGGGGAACCAGAGCC
GGAGCAGGAAAAATAGGTCGAATGATCGCGGAGGAAATCATGGAAATCCACAGGATAAGAGGGTCATCGC
CTTCCAGCTGTGGCTCCAGCCCGCTGAACATCACAAGTACGCCTCCCCCTGATGCCTCTTCTCCAGGAGG
CAAGAAGATTCTAAATGGAGGGACTCCAGACATTCCTTCCACTGGACTATTACCAGGGCAGGCTCAGGAG
ACCCCAGGGTATCCCTATTCTGATAGTTCTTCTATTCTTGGTGAGAACCCCCACATAGGCATCGATATGA
TAGATAACGACCAAGGATCAAGTAGTCCCAGTAACGATGAGGCAGCAATGGCTGTCATCATGAGCCTCTT
GGAAGCAGATGCGGGGCTGGGTGGCCCCGTTGACTTTAGTGACTTGCCATGGCCGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209553 representing NM_007489
Red=Cloning site Green=Tags(s)

MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQESMDTDKDDPHGRLEYAEHQGRI
KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT
FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS
SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFC
TIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKF
VFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRA
GAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQE
TPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007489
ORF Size 1878 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007489.1, NM_007489.2, NM_007489.3, NM_007489.4, NP_031515
RefSeq Size 2904
RefSeq ORF 1881
Locus ID 11865
Cytogenetics 7 F1|7 59.17 cM
MW 69.1 kDa
Gene Summary The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with Clock. This heterodimer binds E-box enhancer elements upstream of Period (Per1, Per2, Per3) and Cryptochrome (Cry1, Cry2) genes and activates transcription of these genes. Per and Cry proteins heterodimerize and repress their own transcription by interacting in a feedback loop with Clock/Arntl complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)