Aatf (NM_019816) Mouse Tagged ORF Clone

CAT#: MR208444

Aatf (Myc-DDK-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf)

Change vector?

  • TrueORF®

USD 98

USD 650


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Aatf (NM_019816) Mouse Tagged ORF Clone
Symbol Aatf
Synonyms 4933415H02Rik; 5830465M17Rik; Che-1; Trb
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR208444 representing NM_019816
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGCCGCAGCCCTTGGCTCTGCAGCTGGAACAGTTGCTGAATCCGAGACCGCGTGAGGCGGATC
CTGAGGCCGACCCGGAGGAGGCCACTAGAGCCAGAGTGATTGACAGGTTTGATGAAGGGGAAGAGGAGAA
AGATGATCTGGCAGTGAGTAGCATTAGAAAGTTGGCACCAGTCTCCCTCTTGGACACCGACAAAAGGTAT
TCTGGCAAGACCACTTCTAGGAAAGCTTGGAAAGAAGACCATTGGGAGCAGGCTCTGCCAAGTTCATCTG
ATAACGAAGCATCTGATGAGGGAGGATCTGAAGATGGGGATTCAGAGGGCCTGGGCCTGGAGGAGATCTC
AGAAGATGTTGACGAAGACTTAGAAGACAACAAAATATCTGATGAGGGAGGATCTGAAGATGGGGATTCA
GAGGGCCTGGGCCTGGAAGAGTTCTCAGAAGATGTTGAGGAGGACTTAGAAGGTGAGGATGAGGAAGACA
GAGAAGAAGACAGGAACAGTGAAGATGATGGTGTGGTGGCAGCCTTCTCCAGTGTCAAAGTTTCTGAGGA
AGTGGAAAAAGGAAGAGCTGTGAAGAATCAGATAGCATTGTGGGACCAGCTCTTGGAAGGAAGGATCAAG
CTACAAAAAGCTCTCTTGACTACCAATCAGTTGCCTCAACCAGATGTTTTCCCTGTCTTCAAGGACAAAG
GTGGCCCAGAATTTGCCAGTGCTCTGAAAAATAGTCACAAAGCACTTAAAGCCTTGTTAAGGTCATTGGT
GGATCTTCAGGAAGAGTTGCTTTTCCAGTACCCAGACACGAGACATATAGTAAATGGGGCGAAACCCAAT
ACAGAGAGTGAGGAGATTTCCAGTGAAGATGATGAGCTAGTGGGAGAGAAGAAGAAACAACGAAAGGCCC
CACCCAAGAGGAAGCTAGAGATGGAGGACTATCCCAGCTTCATGGCAAAGCGCTTTGCTGACTTCACCAT
CTATAGGAATCACACACTACAGAAATGGCATGATAAAACCAAGCTTGCTTCTGGAAAACTGGGCAAGGGT
TTTGGTGCCTTCGAACGCTCGATCTTGACTCAGATCGATCATATCATGATGGACAAAGAAAGATTGCTTC
GGAGGACACAGACCAAGCGCTCTGCCTACCGAGTTCTTGGCAAACCGGAGCCAGTCCCTGAGCCTGTTGC
AGAGACCTTGCCAGGAGAACCAGAGACGCTTCCTCAGGGCCCTGCCAATGCCCACCTGAGGGACTTGGAT
GAGGAGATATTTGATGATGATGACTTTTACCACCAGCTCCTTCGAGAACTCATAGAGCGGAAAACCAGCT
CTTTGGATCCAAATGATCAGGTGGCCATGGGAAGGCAGTGGCTTGCAATCCAGAAACTACGAAGCAAAAT
CCGCAAGAAGGTAGATAGAAAAGCCAGCAAAGGAAGGAAACTTCGGTTCCATGTCCTTAGCAAGCTCCTG
AGTTTCATGGCACCTATTGACCACACCGCAATGAGTGATGATGCCAGGACGGAGTTGTTTCGATCTCTTT
TCGGCCAGCTCAACCCTCCTGATGCAGACCGTGGGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR208444 representing NM_019816
Red=Cloning site Green=Tags(s)

MAAPQPLALQLEQLLNPRPREADPEADPEEATRARVIDRFDEGEEEKDDLAVSSIRKLAPVSLLDTDKRY
SGKTTSRKAWKEDHWEQALPSSSDNEASDEGGSEDGDSEGLGLEEISEDVDEDLEDNKISDEGGSEDGDS
EGLGLEEFSEDVEEDLEGEDEEDREEDRNSEDDGVVAAFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIK
LQKALLTTNQLPQPDVFPVFKDKGGPEFASALKNSHKALKALLRSLVDLQEELLFQYPDTRHIVNGAKPN
TESEEISSEDDELVGEKKKQRKAPPKRKLEMEDYPSFMAKRFADFTIYRNHTLQKWHDKTKLASGKLGKG
FGAFERSILTQIDHIMMDKERLLRRTQTKRSAYRVLGKPEPVPEPVAETLPGEPETLPQGPANAHLRDLD
EEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIRKKVDRKASKGRKLRFHVLSKLL
SFMAPIDHTAMSDDARTELFRSLFGQLNPPDADRGK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019816
ORF Size 1578 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019816.1, NP_062790
RefSeq Size 1844
RefSeq ORF 1581
Locus ID 56321
Cytogenetics 11|11 C
MW 59.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.