Foxo1 (NM_019739) Mouse Tagged ORF Clone

CAT#: MG227240

Foxo1 (GFP-tagged) - Mouse forkhead box O1 (Foxo1), (10ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 917.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Foxo1 (NM_019739) Mouse Tagged ORF Clone
Symbol Foxo1
Synonyms Afxh; AI876417; FKHR; Fkhr1; Foxo1a
Vector pCMV6-AC-GFP
Sequence Data
>MG227240 representing NM_019739
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAAGCGCCCCAGGTGGTGGAGACCGACCCGGACTTCGAGCCGCTGCCCCGGCAGCGCTCCTGTA
CCTGGCCGCTGCCCAGGCCGGAGTTTAACCAGTCCAACTCGACCACCTCCAGTCCGGCGCCGTCGGGCGG
CGCGGCCGCCAACCCCGACGCCGCGGCGAGCCTGGCCTCGGCGTCCGCTGTCAGCACCGACTTTATGAGC
AACCTGAGCCTGCTGGAGGAGAGTGAGGACTTCGCGCGGGCGCCAGGCTGCGTGGCCGTGGCGGCGGCGG
CTGCGGCCAGCAGGGGCCTGTGCGGGGACTTCCAGGGCCCCGAGGCGGGCTGCGTGCACCCAGCGCCGCC
ACAGCCCCCACCGACCGGGCCGCTGTCGCAGCCCCCACCCGTGCCTCCCTCCGCTGCCGCCGCCGCGGGG
CCACTCGCGGGACAGCCGCGCAAGACCAGCTCGTCGCGCCGCAACGCGTGGGGCAACCTGTCGTACGCCG
ACCTCATCACCAAGGCCATCGAGAGCTCAGCCGAGAAGAGGCTCACCCTGTCGCAGATCTACGAGTGGAT
GGTGAAGAGCGTGCCCTACTTCAAGGATAAGGGCGACAGCAACAGCTCGGCGGGCTGGAAGAATTCAATT
CGCCACAATCTGTCCCTTCACAGCAAGTTTATTCGAGTGCAGAATGAAGGAACTGGAAAGAGTTCTTGGT
GGATGCTCAATCCAGAGGGAGGCAAGAGCGGAAAATCACCCCGGAGAAGAGCTGCGTCCATGGACAACAA
CAGTAAATTTGCTAAGAGCCGAGGGCGGGCTGCTAAGAAAAAAGCATCTCTCCAGTCTGGGCAAGAGGGT
CCTGGAGACAGCCCTGGGTCTCAGTTTTCTAAGTGGCCTGCGAGTCCTGGGTCCCACAGCAACGATGACT
TTGATAACTGGAGTACATTTCGTCCTCGAACCAGCTCAAATGCTAGTACCATCAGTGGGAGACTTTCTCC
CATCATGACAGAGCAGGATGACCTGGGAGATGGGGACGTGCATTCCCTGGTGTATCCACCCTCTGCTGCC
AAGATGGCGTCTACGCTGCCCAGTCTGTCTGAAATCAGCAATCCAGAAAACATGGAGAACCTTCTGGATA
ATCTCAACCTTCTCTCGTCCCCAACATCTTTAACTGTGTCCACCCAGTCCTCGCCTGGCAGCATGATGCA
GCAGACACCATGCTATTCGTTTGCACCGCCAAACACCAGTCTAAATTCACCCAGTCCAAACTACTCAAAG
TACACATACGGCCAATCCAGCATGAGCCCTTTGCCCCAGATGCCTATGCAGACACTTCAGGACAGCAAAT
CAAGTTACGGAGGATTGAACCAGTATAACTGTGCCCCAGGACTCTTGAAAGAGTTGTTGACTTCTGACTC
TCCTCCCCACAATGACATTATGTCACCGGTTGATCCCGGAGTGGCCCAACCCAACAGTCGGGTCCTGGGC
CAAAATGTAATGATGGGCCCTAATTCGGTCATGCCAGCGTATGGCAGCCAGGCATCTCATAACAAAATGA
TGAACCCCAGCTCCCACACCCACCCTGGACATGCACAGCAAACGGCTTCGGTCAACGGCCGTACCCTGCC
CCATGTGGTGAACACCATGCCTCACACATCTGCCATGAACCGCTTGACCCCCGTGAAGACACCTTTACAA
GTGCCTCTGTCCCACCCCATGCAGATGAGTGCCCTGGGCAGCTACTCCTCGGTGAGCAGCTGCAATGGCT
ATGGTAGGATGGGTGTCCTCCACCAGGAGAAGCTCCCAAGTGACTTGGATGGCATGTTTATTGAGCGCTT
GGACTGTGACATGGAGTCCATCATTCGGAATGACCTCATGGATGGAGATACCTTGGATTTTAACTTTGAT
AATGTGTTGCCCAACCAAAGCTTCCCACACAGTGTCAAGACTACAACACACAGCTGGGTGTCAGGC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG227240 representing NM_019739
Red=Cloning site Green=Tags(s)

MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMS
NLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAG
PLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSI
RHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEG
PGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAA
KMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSK
YTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLG
QNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQ
VPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFD
NVLPNQSFPHSVKTTTHSWVSG

SGPTRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_019739
ORF Size 1956 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019739.3, NP_062713
RefSeq Size 5552
RefSeq ORF 1959
Locus ID 56458
Cytogenetics 3 C|3 23.19 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)