Cpeb4 (NM_026252) Mouse Tagged ORF Clone

CAT#: MG224198

  • TrueORF®

Cpeb4 (GFP-tagged) - Mouse cytoplasmic polyadenylation element binding protein 4 (Cpeb4), (10ug)

  View "NM_026252" in other vectors (10)

USD 1,060.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Cpeb4 (NM_026252) Mouse Tagged ORF Clone
Symbol Cpeb4
Synonyms Cpe-bp4; Cpeb-4; mCPEB-4
Vector pCMV6-AC-GFP
Sequence Data
>MG224198 representing NM_026252
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGATTACGGGTTTGGAGTGCTAGTGCAAAGCAATACTGGGAATAAATCTGCTTTTCCAGTCCGAT
TCCATCCACATCTGCAGCCTCCACACCATCACCAAAATGCCACCCCCAACCCTGCTGCTTTTATAAATAA
TAACACAGCTGCCAATGGCAGCAGTGCTGGGTCAGCCTGGCTCTTTCCTGCCCCGGCTACTCATAACATT
CAGGATGAGATCTTGGGGTCAGAAAAAGCAAAAAGTCAACAGCAAGAACAACAAGACCCTTTAGAAAAGC
AACAGCTCTCCCCGAGTCCAGGTCAGGAAGCTGGAATACTGCCTGAAACTGAAAAGGCAAAAGCTGAAGA
AAATCCAGGGGACAGTTCTTCAGAAAACAGCAACGGAAAAGAAAAACTACGCATTGAATCACCAGTGTTG
ACAGGGTTTGATTACCAAGAAGCCACCGGTCTCGGGACTTCCACCCAACCCTTGACATCCAGTGCATCGT
CCCTTACTGGTTTCAGTAACTGGTCAGCAGCGATAGCACCTTCTTCCTCCACTATAATCAATGAAGATGC
AAGTTTCTTTCACCAGGGAGGGGTCCCTGGCGCTTCAGCTAATAATGGTGCTCTCTTGTTTCAAAATTTT
CCCCATCATGTCAGCCCTGGCTTTGGTGGTAGCTTCTCCCCTCAGATCGGGCCTCTCTCCCAGCACCATC
CTCATCACCCCCATTTCCAGCACCATCACAGCCAGCATCAGCAGCAGAGGAGGTCTCCTGCCAGTCCCCA
CCCCCCACCTTTCACACATAGAAGTGCTGCTTTTAACCAGCTGCCTCATTTGGCGAATAATCTTAACAAA
CCTCCTTCTCCATGGAGCAGCTACCAAAGTCCTTCTCCAACCCCCTCTTCTTCCTGGAGCCCAGGAGGTG
GCGGCTACGGTGGCTGGGGAGCATCTCAAGGCCGGGATCACCGCAGAGGGCTGAACGGTGGAATAACACC
CCTGAACTCAATCTCACCTTTGAAGAAAAATTTCGCAAGCAATCATATTCAGCTCCAGAAGTATGCTCGC
CCTAGCTCAGCCTTTGCTCCAAAATCCTGGATGGAAGATAGCTTGAACAGGGCTGACAACATTTTTCCTT
TTCCGGAACGCCCCAGGACGTTTGACATGCACTCACTGGAGAGCTCACTCATTGACATAATGAGAGCTGA
AAATGATTCCATTAAAGGTCGTCTAAACTATTCATACCCAGGATCCGATAGTTCTCTGCTTATTAATGCA
AGGACTTATGGGCGAAGGAGAGGTCAGTCTTCATTGTTTCCGATGGAAGATGGATTCCTGGATGATGGCC
GTGGGGATCAACCTCTTCATAGTGGTCTGGGGTCACCTCACTGCTTCACTCACCAGAATGGGGAGAGAGT
GGAACGATACTCTCGCAAAGTGTTTGTGGGTGGATTGCCTCCTGATATTGATGAAGATGAGATCACAGCT
AGTTTCCGTCGCTTTGGCCCTTTGATTGTGGATTGGCCTCATAAGGCAGAGAGCAAATCTTATTTTCCAC
CAAAAGGCTATGCATTCCTGCTGTTTCAAGATGAAAGTTCTGTTCAGGCTCTCATTGATGCATGTATTGA
AGAAGATGGAAAACTTTACCTGTGTGTATCAAGTCCAACCATCAAGGATAAACCAGTGCAGATCCGGCCC
TGGAATCTCAGTGACAGTGACTTTGTGATGGATGGCTCACAGCCACTTGACCCACGGAAAACAATATTTG
TTGGTGGTGTTCCTCGACCATTACGAGCTGTGGAGCTTGCAATGATAATGGATCGGCTGTATGGAGGCGT
CTGCTATGCTGGAATCGATACTGACCCAGAGCTCAAATACCCAAAAGGAGCTGGAAGAGTCGCGTTTTCT
AATCAACAGAGTTACATAGCTGCTATCAGTGCCCGCTTTGTTCAGCTGCAGCATGGAGAGATAGATAAAC
GGGTGGAGGTTAAGCCATATGTCTTGGATGACCAGCTGTGTGATGAATGTCAAGGGGCCCGTTGTGGGGG
GAAATTTGCTCCATTTTTCTGTGCTAATGTTACCTGTCTGCAGTATTACTGTGAATATTGCTGGGCTGCT
ATTCACTCTCGTGCTGGCAGAGAATTCCACAAGCCCCTGGTGAAGGAAGGTGGTGACCGCCCTCGGCATA
TTTCATTCCGCTGGAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG224198 representing NM_026252
Red=Cloning site Green=Tags(s)

MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPNPAAFINNNTAANGSSAGSAWLFPAPATHNI
QDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKAEENPGDSSSENSNGKEKLRIESPVL
TGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPGASANNGALLFQNF
PHHVSPGFGGSFSPQIGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRSAAFNQLPHLANNLNK
PPSPWSSYQSPSPTPSSSWSPGGGGYGGWGASQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYAR
PSSAFAPKSWMEDSLNRADNIFPFPERPRTFDMHSLESSLIDIMRAENDSIKGRLNYSYPGSDSSLLINA
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFTHQNGERVERYSRKVFVGGLPPDIDEDEITA
SFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFS
NQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAA
IHSRAGREFHKPLVKEGGDRPRHISFRWN

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_026252
ORF Size 2187 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_026252.3, NP_080528
RefSeq Size 2312
RefSeq ORF 2190
Locus ID 67579
Cytogenetics 11|11 A4

Other Versions

Other products for "Cpeb4"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies