Dach1 (NM_007826) Mouse Tagged ORF Clone

CAT#: MG216327

Dach1 (GFP-tagged) - Mouse dachshund 1 (Drosophila) (Dach1) transcript variant 1, (10ug)

Change vector?

  • TrueORF®

USD 1,051


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Dach1 (NM_007826) Mouse Tagged ORF Clone
Symbol Dach1
Synonyms Dac; Dach
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG216327 representing NM_007826
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGTGCCGGCGGCTTTGATCCCTCCGACCCAGCTGGTCCCCCCTCAACCCCCGATCTCTACTTCTG
CTTCCTCCTCGGGCACCACCACCTCCACCTCCTCGGCGACCTCGTCTCCGGCTCCATCCATCGGACCCCC
GGCGTCGTCTGGGCCAACTCTGTTCCGGCCGGAGCCCATTGCCTCTTCTGCTTCTTCTTCAGCCGCGGCC
ACAGTCACCTCTCCTGGTGGCGGCGGCGGCGGCAGCGGAGGCGGCGGTGGCAGCGGCGGCAACGGAGGCG
GCGGCGGGAGCAACTGCAACCCCAGCCTGGCGGCCGGGAGCAGCGGCGGCGGCGTTAGCGCTGGCGGCGG
CGGCGCCTCCAGCACCCCCATCACCGCGAGCACCGGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGT
AGCAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGTAGCAGCAGCAGCTGCGGCCCCCTCCCTGGGAAAC
CCGTGTACTCAACCCCGTCCCCAGTGGAAAACACCCCCCAGAATAATGAGTGCAAAATGGTGGATCTGAG
AGGGGCCAAAGTGGCTTCCTTTACGGTGGAGGGCTGCGAGCTGATCTGCCTGCCCCAGGCTTTCGACCTG
TTCCTGAAGCACTTGGTGGGGGGCTTGCACACCGTCTACACCAAGCTGAAGCGGTTGGAGATCACGCCGG
TGGTGTGCAATGTGGAACAGGTTCGCATCCTGAGGGGACTGGGGGCCATCCAGCCCGGAGTGAACCGCTG
CAAACTCATCTCCAGGAAGGACTTCGAGACCCTCTACAATGACTGCACCAACGCCAGTTCCAGACCTGGA
AGGCCTCCTAAGAGGACTCAAAGTGTCACTTCCCCAGAGAACTCTCACATCATGCCGCATTCTGTCCCTG
GCCTCATGTCTCCTGGAATCATTCCACCAACAGGTCTGACTGCAGCTGCTGCAGCTGCTGCAGCTGCTAC
CAATGCAGCTATTGCTGAAGCAATGAAGGTGAAAAAAATAAAATTAGAAGCTATGAGCAACTATCATGCC
AGTAACAACCAACATGGAGCAGATTCTGAAAACGGGGACATGAATTCAAGTGTTGGCAGCAGTGGTGGTT
CTTGGGATAAGGAAACACTGCACTCTCCCCCATCCCAGGGATCCCAGGCTCCTGTTGCACATGCCCGCAT
GCCTGCAGCGTTTAGCCTTCCAGTTAGCCATCCTCTCAACCATCTGCAGCACAGCCACCTTCCGCCAAAT
GGACTGGAACTTCCTTTTATGATGATGCCCCACCCTCTCATTCCTGTCAGCCTACCTCCAGCATCTGTCA
CCATGGCAATGAGTCAGATGAACCACCTTAGCACCATTGCAAATATGGCGGCGGCAGCACAAGTTCAGAG
TCCTCCATCCAGGGTGGAGACATCTGTTATTAAGGAGCGTGTTCCCGACAGTCCCTCGCCTGCTCCATCT
CTGGAGGAGGGCCGGAGGCCCGGCAGCCACCCATCCTCACACCGCAGCAGCAGTGTGTCCAGCTCCCCGG
CGCGGACTGAGAGTTCTTCCGACAGAATCCCTGTCCATCAGAATGGCCTGTCCATGAACCAGATGCTTAT
GGGTTTATCCCCAAATGTGCTTCCTGGGCCAAAGGAGGGGGATTTGGCTGGTCATGACATGGGGCATGAG
TCAAAACGGATCCACATTGAAAAAGATGAGACCCCACTTTCCACACCAACCGCAAGAGACAGCATCGACA
AACTTTCTCTAACTGGGCATGGACAACCACTACCTCCCGGCTTCCCATCTCCCTTTCTGTTTCCTGATGG
CCTGTCCTCCATAGAGACTCTTCTCACTAACATACAGGGCCTCTTGAAAGTTGCCATAGACAATGCCAGA
GCTCAAGAAAAGCAGGTCCAACTGGAAAAAACAGAGCTGAAGATGGATTTTTTAAGAGAAAGAGAACTAA
GAGAAACACTGGAGAAGCAGCTGGCCATGGAACAAAAGAACAGAGCCATAGTTCAAAAGAGGCTAAAGAA
GGAAAAGAAAGCAAAGAGAAAACTGCAGGAGGCACTAGAATTTGAGACAAAACGCCGTGAGCAAGCGGAG
CAGACACTGAAACAGGCAGCTTCAGCGGACAGTCTCCGGGTCTTAAATGACTCCCTGACCCCTGAGATAG
AAGCTGACCGCAGCGGAGGGAGAGCAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAAC
TACTGTCATGTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216327 representing NM_007826
Red=Cloning site Green=Tags(s)

MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPIASSASSSAAA
TVTSPGGGGGGSGGGGGSGGNGGGGGSNCNPSLAAGSSGGGVSAGGGGASSTPITASTGSSSSSSSSSSS
SSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDL
FLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPG
RPPKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHA
SNNQHGADSENGDMNSSVGSSGGSWDKETLHSPPSQGSQAPVAHARMPAAFSLPVSHPLNHLQHSHLPPN
GLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVETSVIKERVPDSPSPAPS
LEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGLSPNVLPGPKEGDLAGHDMGHE
SKRIHIEKDETPLSTPTARDSIDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNAR
AQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAE
QTLKQAASADSLRVLNDSLTPEIEADRSGGRADAERTIQDGRLYLKTTVMY

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007826
ORF Size 2253 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007826.2, NP_031852
RefSeq Size 5225
RefSeq ORF 2256
Locus ID 13134
Cytogenetics 14 E2.1|14 48.25 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations