Mybbp1a (NM_016776) Mouse Tagged ORF Clone

CAT#: MG211937

Reviews ()
Write a review
  • TrueORF®

Mybbp1a (GFP-tagged) - Mouse MYB binding protein (P160) 1a (Mybbp1a)



  "NM_016776" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,350.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Other products for "Mybbp1a"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Mybbp1a
Synonyms AL024407; AU019902; p67MBP; P160; p160MBP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG211937 representing NM_016776
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGATGAAGAGCCCCACGAAAGCTGAGCCTGCGACTCCCGCAGAAGCGGCGCAAAGCGACCGCC
ACAGCCTGCTGGAGCACAGCCGCGAGTTCTTGGACTTCTTCTGGGACATTGCGAAACCGGATCAGGAAAC
GCGGCTCCGGGCCACGGAGAAGTTGTTGGAGTACTTGCGCACAAGGCCCAATGATTCGGAGATGAAATAT
GCCCTGAAGCGCCTAATCACTGGGCTTGGGGTGGGCCGAGAAGCCGCTAGGCCCTGCTACAGCCTGGCGC
TGGCACAGCTGTTGCAGTCTTTTGAAGACATCCCATTGTGTGACATCCTGGATCAGATACAAGAAAAATA
CAGCCTACAAGCCATGAACAAGGCAATGATGAGACCTAGTCTCTTTGCAAACCTTTTTGGAGTGCTAGCC
CTCTTTCAGTCAGGCCGCCTAGTGAAGGACAAAGAGGCCCTGATGAAGTCCGTGCAATTGCTGAAGATCC
TGTCCCAACACCCCAACCACTTACAGGGACAGCCAATAAAGGCTCTGGTGGACATCCTCTCTGAGGTCCC
AGAGTCCATGTTCCAGGAGATCCTGCCAAAGGTCCTCAAGGGTAACATGAAAGTGATCCTCCGCTCTCCC
AAGTACTTGGAGCTCTTCCTCCTGGCTAAGCAGAGGGTGCCGACAAAGCTCGAGTCACTCATGGGCTCGG
TTGACCTGTTCTCAGAAGACAATATTCCCAGTCTGGTGAACATCCTGAAGGTGGCCGCCAACTCTGTCAA
GAAGGAGCACAAGCTGCCTAATGTGGCTCTGGACCTGCTCCGCCTGGCGCTCAAGGAGAGCAGATTCGAA
CTGTTCTGGAAGAAGGTTTTGGAGGAGGGGCTGCTGAAGAATCCGTCCTGGACATCCAGCTACATGTGCT
TCCGCCTACTGGGTGCGTCTCTGCCGCTTCTGTCAGAGGAGCAGTTGCAGTTGGTGATGCGAGGAGACTT
GATCCGCCATTTTGGGGAGAACATGGTTATTTCTAAGCCCCAAAACCTATTTAAGATCATCCCAGAGATA
AGTACATACGTGGGTACCTTCCTAGAGGGGTGCCAGGATGACCCTAAGCGGCAGTTGACTATGATGGTGG
CCTTTACAACCATCACCAATCAAGGTCTCCCTGTCATGCCTACCTTCTGGCGTGTCACGCGGTTTTTGAA
TGCTGAAGCCCTGCAGAGCTATGTGGCCTGGTTGCGGGACATGTTCCTGCAGCCTGACCTGAACTCCTTG
GTTGACTTCAGCACTGCCAACCAGAAGAGAGCTCAGGACGCCTCGTTGAATGTGCCTGAGCGAGCTGTAT
TCCGGCTCCGGAAGTGGATCATCCACCGCCTGGTCAGCCTTGTGGATCATTTGCATCTGGAGAAGGATGA
AGCTGTGGTTGAGCAAATAGCCAGGTTTTGCTTGTTCCATGCCTTCTTTAAGACGAAGAAGGCTACGCCC
CAGATCCCAGAGACGAAGCAGCACTTCTCCTTCCCTTTGGACGACCGCAACCGTGGGGTCTTTGTCAGTG
CCTTCTTCAGCCTACTGCAGACGCTCAGTGTGAAGTTCAGGCAGACACCAGACCTGGCTGAAAATGGGAA
GCCTTGGACTTACCGCCTGGTTCAGTTGGCAGACATGCTGTTGAACCATAACCGCAATGTAACCAGTGTG
ACATCCTTGACAACACAGCAGCGTCAGGCCTGGGACCAGATGATGAGTACTCTGAAGGAATTAGAGGCCC
GCTCCTCTGAGACCAGGGCCATTGCCTTCCAGCACCTGCTGCTTCTGGTGGGCCTCCACATCTTCAAGTC
CCCTGCAGAAAGCTGTGATGTCCTAGGAGACATTCAGACTTGCATCAAGAAAAGCATGGAGCAGAATCCC
CGCCGATCACGCTCTAGAGCCAAAGCCTCCCAGGAGCCAGTATGGGTGGAGGTGATGGTGGAGATCTTGC
TGTCCTTGCTGGCTCAACCCAGCAACTTGATGCGCCAGGTGGTCCGGAGTGTATTTGGTCATATCTGTCC
CCACCTTACTCCACGTTGTCTGCAGCTAATCCTGGCTGTGCTCAGCCCTGTGACAAACGAGGATGAGGAT
GACAACGTGGTGGTCACTGATGACGCTGATGAGAAGCAGCTGCAGCATGGAGAGGACGAAGACTCAGATA
ATGAGGACAATAAGAACTCAGAGAGTGACATGGACAGTGAGGATGGGGAAGAAAGTGAAGAGGAGGACCG
TGACAAAGATGTGGACCCAGGCTTCCGTCAACAGTTGATGGAAGTGTTAAAAGCTGGGAATGCATTGGGT
GGAGTGGACAACGAGGAGGAGGAGGAGCTTGGGGATGAGGCCATGATGGCCCTGGACCAGAACCTGGCCA
GCCTATTTAAAGAGCAGAAGATGCGCATCCAGGCCCGGAATGAGGAGAAAAACAAGCTACAGAAGGAGAA
GAAGCTCCGACGGGACTTCCAAATCAGGGCACTAGACCTGATCGAGGTGCTGGTGACCAAGCAGCCTGAG
CACCCCCTGATCCTGGAACTACTTGAGCCACTGCTGAACGTGATCCAGCACAGCATGCGCAGCAAAGGCT
CCACCAAGCAGGAGCAGGACCTCCTGCACAAGACCGCCCGCATCTTCATGCACCACCTGTGTCGTGCCCG
CCGCTACTGCCACGAGGTGGGGCCGTGTGCAGAGGCTCTGCATGCCCAGGTGGAGAGGCTTGTGCAGCAG
GCTGGCAGCCAGGCTGATGCCTCTGTCGCCCTATACTATTTCAATGCCTCTCTGTACCTGCTGCGAGTCC
TCAAGGGCAACACCAATAAGAGGCACCAAGATGGTCATAAGTTACACGGAGCTGACACAGAGGACTCAGA
GGACCAGGCTGCTAACTGCTTAGACTTGGACTTTGTGACCCGGGTGTATTCAGCATCACTGGAATCTCTT
CTGACCAAGCGTAACAGCTCACTTACGGTCCCCATGTTCCTCAGCCTCTTCTCCAGATACCCAGTGATCT
GTAAGAACCTGCTTCCCGTCCTGGCTCAGCATGTGGCTGGCCCATCTCGGCCCCGCCATCAGGCCCAGGC
ATGCCTGATGCTCCAGAAGACTCTGTCTGCACGAGAGCTGAGAGTCTGTTTTGAGGATCCTGAGTGGGAG
CAGCTGATTACCCAACTCTTGGGAAAGGCCACCCAGACCCTGCAGACTCTTGGGGAGGCACAGAGCAAGG
GGGAGCACCAGAAGGAGCTATCCATCTTGGAGCTGCTGAACACTCTGTTGAGGACAGTCAATCACGAGAA
GCTGTCTGTGGACCTCACTGCTCCCTTGGGCGTGCTTCAGAGCAAGCAACAGAAGCTGCAGCAAAGCCTG
CAGCAGGGGAATCACTCATCTGGCTCCAATCGCCTCTATGATCTCTACTGGCAGGCCATGAGGATGCTAG
GAGTCCAACGTCCAAAGTCAGAAAAGAAGAATGCCAAGGATATTCCTAGTGACACCCAGAGCCCCGTCAG
CACAAAGCGGAAGAAAAAGGGATTCTTGCCAGAGACCAAGAAGCGAAAGAAACTTAAATCTGAGGGCACC
ACACCAGAAAAGAATGCTGCGTCACAGCAGGATGCAGTGACAGAGGGTGCCATGCCTGCTGCCACTGGTA
AAGACCAGCCCCCCAGCACAGGCAAGAAGAAAAGGAAGAGGGTAAAGGCCAGCACCCCATCCCAGGTGAA
TGGGATAACTGGGGCCAAGAGTCCAGCTCCCAGTAACCCCACCCTAAGCCCCAGCACCCCTGCCAAGACC
CCAAAACTGCAGAAGAAAAAAGAGAAGCTGTCACAGGTGAATGGAGCCACTCCTGTGTCCCCCATAGAGC
CTGAAAGCAAAAAGCATCATCAGGAGGCACTCAGCACAAAGGAGGTCATAAGAAAGTCCCCCCACCCCCA
GTCTGCCCTGCCAAAGAAAAGAGCAAGGCTGTCTCTGGTGAGCAGGAGCCCCAGCCTGTTACAGAGTGGG
GTCAAGAAAAGGAGAGTGGCCAGCAGGAGAGTGCAGACACCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG211937 representing NM_016776
Red=Cloning site Green=Tags(s)

MAEMKSPTKAEPATPAEAAQSDRHSLLEHSREFLDFFWDIAKPDQETRLRATEKLLEYLRTRPNDSEMKY
ALKRLITGLGVGREAARPCYSLALAQLLQSFEDIPLCDILDQIQEKYSLQAMNKAMMRPSLFANLFGVLA
LFQSGRLVKDKEALMKSVQLLKILSQHPNHLQGQPIKALVDILSEVPESMFQEILPKVLKGNMKVILRSP
KYLELFLLAKQRVPTKLESLMGSVDLFSEDNIPSLVNILKVAANSVKKEHKLPNVALDLLRLALKESRFE
LFWKKVLEEGLLKNPSWTSSYMCFRLLGASLPLLSEEQLQLVMRGDLIRHFGENMVISKPQNLFKIIPEI
STYVGTFLEGCQDDPKRQLTMMVAFTTITNQGLPVMPTFWRVTRFLNAEALQSYVAWLRDMFLQPDLNSL
VDFSTANQKRAQDASLNVPERAVFRLRKWIIHRLVSLVDHLHLEKDEAVVEQIARFCLFHAFFKTKKATP
QIPETKQHFSFPLDDRNRGVFVSAFFSLLQTLSVKFRQTPDLAENGKPWTYRLVQLADMLLNHNRNVTSV
TSLTTQQRQAWDQMMSTLKELEARSSETRAIAFQHLLLLVGLHIFKSPAESCDVLGDIQTCIKKSMEQNP
RRSRSRAKASQEPVWVEVMVEILLSLLAQPSNLMRQVVRSVFGHICPHLTPRCLQLILAVLSPVTNEDED
DNVVVTDDADEKQLQHGEDEDSDNEDNKNSESDMDSEDGEESEEEDRDKDVDPGFRQQLMEVLKAGNALG
GVDNEEEEELGDEAMMALDQNLASLFKEQKMRIQARNEEKNKLQKEKKLRRDFQIRALDLIEVLVTKQPE
HPLILELLEPLLNVIQHSMRSKGSTKQEQDLLHKTARIFMHHLCRARRYCHEVGPCAEALHAQVERLVQQ
AGSQADASVALYYFNASLYLLRVLKGNTNKRHQDGHKLHGADTEDSEDQAANCLDLDFVTRVYSASLESL
LTKRNSSLTVPMFLSLFSRYPVICKNLLPVLAQHVAGPSRPRHQAQACLMLQKTLSARELRVCFEDPEWE
QLITQLLGKATQTLQTLGEAQSKGEHQKELSILELLNTLLRTVNHEKLSVDLTAPLGVLQSKQQKLQQSL
QQGNHSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGT
TPEKNAASQQDAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNPTLSPSTPAKT
PKLQKKKEKLSQVNGATPVSPIEPESKKHHQEALSTKEVIRKSPHPQSALPKKRARLSLVSRSPSLLQSG
VKKRRVASRRVQTP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016776
ORF Size 4032 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016776.3
RefSeq Size 4215 bp
RefSeq ORF 4035 bp
Locus ID 18432
UniProt ID Q7TPV4
Cytogenetics 11 44.29 cM
Gene Summary May activate or repress transcription via interactions with sequence specific DNA-binding proteins (PubMed:9447996, PubMed:11956195, PubMed:14744933). Repression may be mediated at least in part by histone deacetylase activity (HDAC activity) (PubMed:14744933). Acts as a corepressor and in concert with CRY1, represses the transcription of the core circadian clock component PER2 (PubMed:19129230). Preferentially binds to dimethylated histone H3 'Lys-9' (H3K9me2) on the PER2 promoter (PubMed:19129230). Has a role in rRNA biogenesis together with PWP1 (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Rabbit Polyclonal Anti-MYBBP1A Antibody
    • 100 ul

USD 485.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.