Mybbp1a Rabbit Polyclonal Antibody

SKU TA342319

Rabbit Polyclonal Anti-MYBBP1A Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYBBP1A antibody: synthetic peptide directed towards the C terminal of mouse MYBBP1A. Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 148 kDa
• Gene Name: MYB binding protein (P160) 1a
• Database Link:
  NP_058056
  Q7TPV4
• Background: Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
• Synonyms: FLJ37886; P160; PAP2
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Pig: 83%; Guinea pig: 83%

Reference Data