Shkbp1 (NM_138676) Mouse Tagged ORF Clone

CAT#: MG210149

Reviews ()
Write a review
  • TrueORF®

Shkbp1 (GFP-tagged) - Mouse Sh3kbp1 binding protein 1 (Shkbp1)



  "NM_138676" in other vectors (4)

USD 750.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Shkbp1 (NM_138676) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Shkbp1
Synonyms B930062H15Rik; Sb1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG210149 representing NM_138676
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGTCGCGACGACTGCAGTGGAGGGGGTCCCGAGTCGGGGAGCACCCGGGGAAGTGATTCATCTGA
ACGTAGGGGGCAAGCGGTTCAGTACCTCTCGCCAGACGCTTACCTGGATCCCAGACTCCTTCTTTTCCAG
TCTTTTGAGCGGACGCATCTCAACCCTGAAAGATGAGACCGGAGCTATCTTCATCGACCGGGACCCCACC
GTCTTTGCCCCCATCCTTAATTTCCTGCGGACCAAAGAGTTAGATCCCAGGGGTGTCCATGGTTCCAGCC
TCCTCCATGAAGCCCAATTCTACGGACTCACTCCACTGGTTCGTCGCCTGCAGGTGAGGGAAGAGTTGGA
TCGATCTTCCTGCGGAAATGTCCTCTTCAATGGTTATCTACCTCCTCCAGTGTTCCCAGTGAAGCGGCGA
AACCGGCACAGCCTGGTGGGGCCCCAGCAAATAGGGGGACGCCCAGCCCCTGTTCGACGGAGCAACACGA
TGCCCCCCAACTTGGGTAATGCAGGGCTGCTGGGCCGAATGTTAGATGAGAGAGCACCTCCATCCCCATC
AGGCCAACCAGAGGAGCCAGGGATGGTGCGCCTGGTGTGTGGTCACCACAACTGGATTGCTGTGGCATAT
ACCCACTTTCTCGTCTGTTATAGGTTGAAGGAAGCCTCGGGCTGGCAGCTTGCATTCTCCAGCCCGCGCC
TGGACTGGCCCATCGAGCGCCTGGCTCTTGCGGCTCGGGTGCTTGGCGGTGCTCCGGGTGAGCATGACAA
GATGGTGGCTGCAGCTACTGGCAGCGAGATCCTTCTGTGGGCCCTACAAGCACAAGGTGGTGGCTCTGAG
ATAGGTGTCTTCCACCTGGGTGTGCCAGTGGAGGCCTTGTTCTTTGTTGGGAATCAGCTCATTGCCACAA
GTCACACAGGGCGCATCGGTGTCTGGAACGCTGTGACCAAGCACTGGCAGGTCCAGGAGGTCCAGCCTAT
CACGAGCTATGATGCAGCCGGCTCCTTCCTCCTCCTGGGCTGCAGCAATGGCTCCATCTATTATGTAGAT
GTGCAGAAATTCCCCCTGCGGATGAAGGACAACGATCTCCTTGTCAGTGAGCTCTACCGAGACCCAGCAG
AGGATGGGGTCACCGCCCTCAGCGTCTACCTCACCCCCAAGACCAGTGACAGTGGGAACTGGATTGAGAT
TGCCTATGGCACCAGCTCCGGGGTGGTGCGGGTCATTGTGCAGCACCCTGAGACGGTGGGCTCGGGACCC
CAGCTCTTCCAGACCTTCAGTGTGCACCGCAGCCCGGTCACTAAGATCATGCTGTCAGAGAAGCATCTTA
TCTCTGTGTGTGCCGACAACAACCATGTTCGGACGTGGTCTGTGACCCGCTTTCGAGGCATGATCTCCAC
CCAGCCTGGTTCCACTCCGCTGGCATCCTTCAAGATCCTGGCGCTGGAATCTGTTGATGGGCTCGGTGGC
TGCAGTGCTGGCAATGACATTGGTCCCTATGGTGAACGGGATGACCAGCAGGTGTTCATCCAGAAAGTGG
TGCCAAATGCCAGTCAGCTATTTGTGCGTCTCTCTTCCACTGGGCAGCGGGTGTGTTCTGTGCGCTCGGT
GGATGGGTCTCCCACGACTGCCTTCACAGTGTTGGAGTGTGAGGGCTCCAGGCGGCTGGGCTCCAGACCC
CGACGTTACCTGCTCACTGGTCAGGCCAACGGCAGCCTGGCCATGTGGGACCTGACCACTGCCATGGATG
GCCTGGGCCAAACTCCTGCAGGCGGCCTGACAGAAGAAGAGCTGATGGACCAACTGGAGCAATGTGAGCT
GAGCCCATTGGCTTCCTCTCGGGGCTCTTTCCCCAGCCCCTCACCCAGGACCTCTCTTACCAGTCTCCAC
TCAGCCTCCAGCAACACCTCCCTGTATGGCCCCAGAGGGAGCCCCAGCCCACCACAGGCAGAGGCCCGTC
GCCGCGGGGCAGGAAGCTTCGTGGATCGGTGTCAGGAACTGGCAAGGGGTGCGCCAGAGCTCAGATGGCC
GCCAACACCAGCCCCTCGACCCTCCACCAGTCTTGGGAATCCCCTGACAGCTCTCAAGAAAACTCTTAAC
GAAACTTCCTTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG210149 representing NM_138676
Red=Cloning site Green=Tags(s)

MAVATTAVEGVPSRGAPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAIFIDRDPT
VFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQVREELDRSSCGNVLFNGYLPPPVFPVKRR
NRHSLVGPQQIGGRPAPVRRSNTMPPNLGNAGLLGRMLDERAPPSPSGQPEEPGMVRLVCGHHNWIAVAY
THFLVCYRLKEASGWQLAFSSPRLDWPIERLALAARVLGGAPGEHDKMVAAATGSEILLWALQAQGGGSE
IGVFHLGVPVEALFFVGNQLIATSHTGRIGVWNAVTKHWQVQEVQPITSYDAAGSFLLLGCSNGSIYYVD
VQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDSGNWIEIAYGTSSGVVRVIVQHPETVGSGP
QLFQTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALESVDGLGG
CSAGNDIGPYGERDDQQVFIQKVVPNASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLECEGSRRLGSRP
RRYLLTGQANGSLAMWDLTTAMDGLGQTPAGGLTEEELMDQLEQCELSPLASSRGSFPSPSPRTSLTSLH
SASSNTSLYGPRGSPSPPQAEARRRGAGSFVDRCQELARGAPELRWPPTPAPRPSTSLGNPLTALKKTLN
ETSF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_138676
ORF Size 2112 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_138676.2, NP_619617.2
RefSeq Size 2347 bp
RefSeq ORF 2115 bp
Locus ID 192192
Cytogenetics 7 A3
Gene Summary Inhibits CBL-SH3KBP1 complex mediated down-regulation of EGFR signaling by sequestration of SH3KBP1. Binds to SH3KBP1 and prevents its interaction with CBL and inhibits translocation of SH3KBP1 to EGFR containing vesicles upon EGF stimulation (PubMed:21830225).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Shkbp1"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 350.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools