Dapk2 (BC022165) Mouse Tagged ORF Clone

CAT#: MG205712

  • TrueORF®

Dapk2 (tGFP-tagged) - Mouse death-associated kinase 2 (cDNA clone MGC:13742 IMAGE:4016911)



Reconstitution Protocol

USD 657.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Dapk2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Dapk2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG205712 representing BC022165
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCAGGCCTCGATGAGGAGCCCAAATATGGAGACGTTCAAACAGCAGAAGGTGGAGGACTTTTATG
ACATCGGAGAGGAGCTGGGCAGTGGCCAGTTTGCCATCGTGAAGAAGTGCCGGGAGAAGAGCACAGGGCT
GGAGTATGCAGCCAAGTTCATTAAGAAGAGGCAGAGCCGGGCCAGCCGTCGGGGCGTGTGCCGGGAGGAA
ATCGAGCGGGAGGTGAGCATCCTGCGGCAGGTGCTGCACCCCAACATCATCACGCTGCACGACGTCTATG
AGAACCGCACCGACGTGGTGCTCATCCTTGAGCTAGTGTCCGGAGGAGAACTGTTTGATTTCCTGGCCCA
GAAGGAGTCGTTAAGTGAGGAGGAAGCCACCAGCTTCATTAAGCAGATCCTGGATGGGGTGAATTACCTT
CACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATCATGTTGTTAGACAAGAATATCCCCA
TTCCACACATCAAGCTGATTGACTTTGGCCTGGCTCACGAAATAGAAGATGGAGTTGAATTTAAAAACAT
TTTTGGGACACCTGAATTTGTTGCTCCAGAAATCGTGAACTATGAGCCACTGGGACTGGAGGCCGACATG
TGGAGCATTGGAGTCATCACCTACATCCTTCTAAGTGGAGCGTCCCCCTTCCTGGGAGACACAAAACAAG
AAACCCTGGCAAATATCACTGCTGTGAGTTACGACTTTGATGAGGAATTCTTCAGCCAGACAAGCGAGCT
GGCCAAGGACTTCATTCGGAAGCTTCTTGTGAAAGAGACCCGGAAACGGCTTACCATCCAAGAGGCTCTC
AGACATCCCTGGATCACGCCGGTGGACACCCAGCAAGCTATGGTACGCAGAGAGTCCGTGGTCAACCTGG
AGAATTTTAAGAAGCAGTATGTCCGCAGGCGGTGGAAGCTGTCCTTCAGCATCGTCTCCTTGTGCAACCA
CCTCACTCGCTCCCTGATGAAGAAGGTACATCTGAGGACAAGCGAGGACCTGAGGAACTGCGAGAGTGAC
ACAGAGGAGAACATCGCCAGGAGGAAAGCCCTTCACCCCCGGAGGAGGAGCAGTACCTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG205712 representing BC022165
Red=Cloning site Green=Tags(s)

MVQASMRSPNMETFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVCREE
IEREVSILRQVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYL
HTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADM
WSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEAL
RHPWITPVDTQQAMVRRESVVNLENFKKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRTSEDLRNCESD
TEENIARRKALHPRRRSSTS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC022165
ORF Size 1112 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC022165, AAH22165
RefSeq Size 1883 bp
RefSeq ORF 1112 bp
Locus ID 13143
Cytogenetics 9 35.75 cM
Gene Summary Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Capable of regulating both type I apoptotic and type II autophagic cell death signals. The former involves caspase activation, chromatin and mitochondrial condensation while the latter involves caspase-independent cell death in conjunction with accumulation of mature autophagic vesicles, plasma membrane blebs, and nuclear condensation without DNA degradation. Mediator of anoikis and a suppressor of beta-catenin-dependent anchorage-independent growth of malignant epithelial cells. May play a role in granulocytic maturation (By similarity). Regulates granulocytes motility by controlling cell spreading and polarization (PubMed:24163421).[UniProtKB/Swiss-Prot Function]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.