Pim2 (BC027376) Mouse Tagged ORF Clone

CAT#: MG204426

  • TrueORF®

Pim2 (tGFP-tagged) - Mouse proviral integration site 2 (cDNA clone MGC:37188 IMAGE:4954711)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "BC027376" in other vectors (4)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


PIM2 Antibody - middle region
    • 100 ul

USD 539.00

Other products for "Pim2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Pim2
Synonyms DXCch3; Pim-2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG204426 representing BC027376
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGACCAAGCCTCTGCAGGGGCATCCTTCGCCCCCTGTGACCCCCACGCAGCCTCCAGGAGGCAAGG
ATCGGGCAGCTTTCGAGGCCGAATACCGACTTGGCCCCCTCCTGGGTAAGGGAGGCTTTGGCACCGTCTT
CGCGGGACACCGCGTCACGGATAGACGTCAGGTGGCCATCAAAGTAATCTCCCGGAACCGTGTGCTAGGC
TGGTCCACCGTGTCAGACTCAGTCACCTGCCCACTTGAGGTTGCGCTGCTGTGGAAGGTGGGTGAAGGCA
ATGGCCATCCGGGTGTGATACGCCTTCTTGACTGGTTCGAAACACCCGAAGGCTTCATGCTGGTCCTTGA
GCGGCCTATGCCTGCTCAGGATCTCTTCGACTATATCACAGAGAAGGGGCCGCTGGGTGAAAGCTGTAGC
CGCAGCTTCTTTACCCAAGTCGTGGCAGCTGTCCAGCACTGCCACGCCCGTGGAGTTGTCCATCGGGATA
TCAAGGATGAGAACATCCTGATCGACCTATGCCGGGGTTCCATTAAACTCATTGATTTTGGTTCCGGCGC
CCTGCTTCACGATGAGCCGTACACTGACTTTGATGGGACAAGAGTGTATAGCCCTCCAGAGTGGATCTCG
CGACACCAGTACCATGCCCTGCCAGCGACCGTCTGGTCACTAGGTGTCCTACTCTATGACATGGTCTGTG
GGGACATTCCCTTCGAGAGAGACCAGGAGATTCTGGAGGCTGAGCTGCACTTCCCTGCTCATGTCTCCCC
AGATTGCTGTGCCCTAATCCGCCGGTGCCTGGCCCCTAAACCCTGCTCCCGACCCTCACTGGAGGAGATT
CTGCTGGACCCCTGGATGCAATCACCAGCTGAAGAAAAGCCCATCAACTCCTCCAAAGGAAGCCCCACCC
CCTTGCCCTGGTCCCTGCTTCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204426 representing BC027376
Red=Cloning site Green=Tags(s)

MLTKPLQGHPSPPVTPTQPPGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLG
WSTVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEGFMLVLERPMPAQDLFDYITEKGPLGESCS
RSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS
RHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEI
LLDPWMQSPAEEKPINSSKGSPTPLPWSLLP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC027376
ORF Size 933 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC027376, AAH27376
RefSeq Size 1974 bp
RefSeq ORF 935 bp
Locus ID 18715
Cytogenetics X 3.55 cM
Gene Summary Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.