Cox6b1 (NM_025628) Mouse Tagged ORF Clone

CAT#: MG200188

Reviews ()
Write a review
  • TrueORF®

Cox6b1 (GFP-tagged) - Mouse cytochrome c oxidase, subunit VIb polypeptide 1 (Cox6b1)



  "NM_025628" in other vectors (4)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 341.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Cox6b1
Synonyms 2010000G05Rik; Cox6b
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG200188 representing NM_025628
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAAGACATCAAGACTAAAATCAAGAACTACAAAACTGCCCCCTTTGACAGCCGCTTCCCCAACC
AGAACCAGACTAAGAACTGTTGGCAGAACTACCTGGACTTCCACCGCTGTGAGAAGGCAATGACGGCCAA
GGGGGGTGATGTCTCCGTGTGTGAGTGGTACCGGCGTGTGTACAAGTCCCTCTGTCCCGTGTCATGGGTC
TCAGCCTGGGATGACCGCATAGCTGAAGGCACATTTCCTGGGAAGATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200188 representing NM_025628
Red=Cloning site Green=Tags(s)

MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWV
SAWDDRIAEGTFPGKI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025628
ORF Size 258 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025628.3
RefSeq Size 506 bp
RefSeq ORF 261 bp
Locus ID 110323
UniProt ID P56391
Cytogenetics 7 18.84 cM
Gene Summary Connects the two COX monomers into the physiological dimeric form.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Cox6b1"
Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 704.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 385.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.